(data stored in SCRATCH zone)

EMBL: CP002505.PE38

CP002505.PE38        Location/Qualifiers
FT   CDS_pept        40352..41851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0038"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain protein"
FT                   /note="KEGG: spe:Spro_0076 transcriptional regulator; PFAM:
FT                   regulatory protein GntR HTH; aminotransferase class I and
FT                   II; SMART: regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71671"
FT                   /db_xref="GOA:A0A0H3F999"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F999"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADW71671.1"
FT                   /translation="MTDTADFSDTRYNQLAEQLADAIRRGTLAPGSRLPSVRRSAQTWS
FT                   VSINTVVAAYRRLEDRGFIEARPQSGFYVRAALPALDHQPQEQPQTPAAEPADEVLDLI
FT                   DKVFASQIDPTYTNLSLACPQSNDFYPTGKLGRIMSSLLRRQPNLIGQYALPPGSPALR
FT                   QQIARRALTLGMILEPADITITHGCMEALQLALRVTTKPGDSIGLETPTYFYLLPMLAS
FT                   LGLKAVEIPTDPQTGLSLDVLEMLLTEKRLNAVIAMPTAQNPLGFTMPLAAKKRLARLM
FT                   NDHQVPLIEDGLYAEIQFGATLSPAVKAFDRDGWILFCTSFTKTLAPDFRIGWVDGGRF
FT                   ADKLHKLKAVSSMAESALLSQTLTLFLESGGYDHHLRVLRKRYASQVEQARALIARHFP
FT                   QGTRATQPAGGFVIWVDFPPGVDCVTLFRQLLKDKICMTPGQLYSPSGRYANGLRLSCC
FT                   YVFDTRYISAMIRIGERACEMCGLPPGLAETQEQAEESHTS"
     atgactgata cagcggattt cagcgacacg cgatataacc aactggcgga acaactggcg        60
     gacgctatcc gccgtggcac actcgcaccg ggcagtcgtt tgccgtccgt gcgacgcagc       120
     gcacaaacct ggtcagtcag tatcaacacc gtggtagctg cttaccggcg gctggaagat       180
     cgcggcttta tcgaggcacg tccgcagtcc ggtttttatg tgcgtgccgc gttgcccgcg       240
     ctggaccatc agccgcagga acagccgcag acgccagcgg cagaaccggc agatgaagtg       300
     ctggatctga tcgacaaagt gttcgcctcg caaattgacc ccacctacac caacttatcg       360
     ctagcctgtc cgcagtcgaa cgatttttac ccgaccggaa aactggggcg gattatgtcg       420
     tcactgctgc gtcgtcagcc caatctgatc gggcaatacg cgctgccgcc gggcagcccg       480
     gcgttacgcc agcaaattgc gcgccgtgca ctgacgctcg gcatgatttt agagcctgcg       540
     gatatcacga ttacgcacgg ttgtatggag gcgttacagc tggcattgcg cgttaccacc       600
     aaacccggcg acagtatcgg gctggaaacg ccgacctatt tttatctgct gccgatgctg       660
     gcgagtctcg gactgaaagc agtggaaatc cccaccgatc cgcaaaccgg cctgtcgctg       720
     gatgtgctgg aaatgctgct gaccgagaaa cggctgaatg cagtgatcgc tatgccgacg       780
     gcgcaaaatc cgctgggctt taccatgcca ctggcggcga aaaaacggct ggcgcggctg       840
     atgaacgatc accaggtccc cctgattgaa gacgggcttt acgcagaaat tcagtttggc       900
     gcgacgctgt ctccggcggt aaaagccttt gaccgggacg gctggatcct gttttgcacc       960
     agctttacca aaacgctggc acctgatttt cgcatcggct gggtggacgg cggacgcttt      1020
     gccgataagt tgcataaact gaaagcggta tcgtcaatgg cagagtccgc cttgctttcc      1080
     caaacgctga cgttgtttct ggaatcgggc ggttacgatc atcatctgcg ggttttacgc      1140
     aaacgctacg cgtcgcaggt ggaacaggcg cgcgcgttga tcgcccgtca cttcccgcag      1200
     ggcacccgcg ccacgcaacc ggcaggcggc tttgttatct gggtggattt cccgccgggc      1260
     gtcgattgcg tcacgctgtt ccgccagtta ctgaaagata aaatctgcat gacgccggga      1320
     caactgtatt caccgagcgg tcgctacgcc aatggcctgc gtttatcgtg ctgttatgtt      1380
     ttcgataccc gctatatttc ggcgatgatc cgcattggcg agcgggcgtg tgagatgtgt      1440
     ggtttgccgc cggggctggc agaaacgcag gagcaagctg aagaatcgca cacttcctga      1500
//

If you have problems or comments...

PBIL Back to PBIL home page