(data stored in SCRATCH zone)

EMBL: CP002505.PE399

CP002505.PE399       Location/Qualifiers
FT   CDS_pept        431774..433420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0402"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: ypb:YPTS_0431 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72032"
FT                   /db_xref="GOA:A0A0H3F5G4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5G4"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADW72032.1"
FT                   /translation="MAAKEVKFGNDARVKMLRGVNILADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVVAAVEELKKLSVPCSDSKAIAQVGTISANSDETVGKLIA
FT                   EAMEKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGSIELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTGGTVISEEIGLELEKATLEDMGQAKRVVINKDTTIIIDGVGEEA
FT                   TIQGRVSQIRQQIEEATSDYDREKLQERVAKLAGGVAVLKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVAGGGVALVRVAHTLANLTGDNDDQNVGIRVALRAMESPLRQIVVNA
FT                   GEEASVIANKVKAGEGSFGYNAYTEEYGDMIAMGILDPTKVTRSALQYASSVAGLMITT
FT                   ECMITDLPKDDKVDMGGAGGMGGMGGMGGMM"
     atggcagcta aagaagtaaa attcggtaac gacgcccgtg tgaaaatgct gcgtggcgta        60
     aacatccttg ctgatgcagt aaaagtgacc ttgggcccta aaggccgtaa cgtggttttg       120
     gacaaatctt tcggcgcacc aaccatcact aaagacggcg tgtccgttgc acgtgaaatc       180
     gaactggaag acaagttcga aaacatgggc gcacagatgg tgaaagaagt cgcgtccaaa       240
     gcgaacgatg cagcgggtga cggtaccact accgcaaccg ttctggctca agccatcatc       300
     actgaaggcc tgaaagctgt tgccgcgggc atgaacccga tggatctgaa acgtggtatc       360
     gacaaagctg tcgttgctgc ggttgaagaa ctgaaaaaat tatctgtccc ttgctctgac       420
     tctaaagcca ttgcacaggt tggtaccatc tctgctaact ccgatgaaac tgtcggtaaa       480
     ctgatcgctg aagcgatgga aaaagtgggc aaagaaggcg tcatcactgt tgaagaaggc       540
     actggcctgc aagatgagct ggacgttgtt gaaggtatgc agttcgaccg tggttatctg       600
     tctccttact tcatcaacaa accagaaacc ggttcaatcg aactggaaag cccgttcatc       660
     ctgctggctg acaagaaaat ttctaacatc cgcgaaatgc tgccagtact ggaagccgtt       720
     gcgaaagccg gtaaaccact gctgatcatt gctgaagacg ttgaaggcga agccctggcg       780
     actctggttg tgaataccat gcgtggcatc gtgaaagtgg ctgcggttaa agcaccaggc       840
     ttcggcgacc gtcgtaaagc tatgctgcag gatatcgcaa ccctgactgg cggtaccgtt       900
     atctctgaag agatcggtct ggaactggaa aaagccactc tggaagatat gggtcaggct       960
     aaacgtgttg ttatcaacaa agacaccacc atcatcatcg atggcgttgg cgaagaagca      1020
     accatccagg gccgtgtttc tcagatccgt cagcagattg aagaagcgac ttctgattat      1080
     gaccgtgaaa aactgcaaga gcgtgtggct aaactggcag gcggcgtagc cgttctgaaa      1140
     gtgggcgcag cgactgaagt tgaaatgaaa gagaagaaag ctcgcgttga agatgccctg      1200
     cacgcaaccc gtgctgcggt agaagaaggc gtggttgctg gtggtggcgt ggcgctggtt      1260
     cgcgttgctc acactctggc taacctgacc ggcgacaacg acgaccagaa cgtgggtatc      1320
     cgcgttgctc tgcgcgcaat ggaatctcca ctgcgtcaga tcgttgtgaa tgctggcgaa      1380
     gaagcctctg ttatcgcaaa caaagtgaaa gcgggcgaag gcagcttcgg ctacaacgct      1440
     tacaccgaag aatacggtga catgatcgca atgggtatcc ttgatccaac taaagtcacc      1500
     cgttctgctc tgcagtacgc gtcttctgta gctggcctga tgatcaccac tgagtgcatg      1560
     atcaccgacc tgcctaaaga cgataaagtc gatatgggcg gcgctggcgg tatgggtgga      1620
     atgggcggca tgggcggcat gatgtaa                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page