(data stored in SCRATCH zone)

EMBL: CP002505.PE403

CP002505.PE403       Location/Qualifiers
FT   CDS_pept        435983..436111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0407"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: spe:Spro_0413
FT                   entericidin EcnAB"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72036"
FT                   /db_xref="GOA:A0A0H3FAI3"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAI3"
FT                   /inference="protein motif:PFAM:PF08085"
FT                   /protein_id="ADW72036.1"
FT                   /translation="MLKKMMFIVVSVMLLASLSGCNTVHGFGEDIQHLGGAISKAG"
     atgttgaaga agatgatgtt tatcgtggtt tcagtgatgc tgctggcttc gttatccggc        60
     tgcaacacgg ttcatggttt cggtgaagac atccagcatc tgggtggcgc aatttccaaa       120
     gcaggctga                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page