(data stored in SCRATCH zone)

EMBL: CP002505.PE413

CP002505.PE413       Location/Qualifiers
FT   CDS_pept        complement(444833..448201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0417"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   yps:YPTB0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72046"
FT                   /db_xref="GOA:A0A0H3FAJ4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAJ4"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADW72046.1"
FT                   /translation="MRLIPALLMSLLLSLPLMAGAAPTEDQLKQELKQAEANKEMANQT
FT                   QVVEALQSALNWLNEASVSAGRTAEYQKVIDDFPKLTQALRQELRNQPDKPPALDNSIS
FT                   AAQLEQQILQVSSQQLEETRQLRQEQDRSRDISDSLSLIPQQQSEARNALSDIDQRIQA
FT                   ATAAATSSPLAQAQLSALQAESAARKAKVDELELAQLSANNRQELSRMRTDLYKKRADF
FT                   LDQQLQVLRNTLNNQRQQEAEQALEKTELLAEQSGELPHSISQQLQANRELSLALNQQA
FT                   QRMDLISSQQRQAAAQTQQVRQAINTIREQAQWLGASNLLGETLRAQVARLPDMPKPQQ
FT                   LDRDMGQLRVQRLHYEDLLDKQAIYRQARQDDGKPLTTDQQKILDAQLRTQRDLLNSLL
FT                   SGCDTQILELTKLKVANSQLVEALNDVHDAAHRYLFWVADVSAIGISYPVQVAHDLKRL
FT                   VSLDSLSQLGGASMMMVTSKETLLPLFGALILVIISISSRKHYYAFLERASSKVGKVTQ
FT                   DHFSLTLRTVFWSILVAMPLPVLWAALGFGLQSAWPYPIAVAIGDGVTATLPILWAFMV
FT                   SAALAHPQGLFVAHFGWPQRAVSRALRYYALSIWVLVPLIMALITFDNLNDREFSNTLG
FT                   RLCFVILCLVVALVTNSLKRAGIPLYHDKKGNSENIINKTLWWMLLGAPIVAALASLMG
FT                   YLATSQALLARLETSVAIWFVLLVIYHIIRRWMLIQRRRIAFERAKQRRAEMLNQRARG
FT                   EEDGHQISTSNEGTVEIEEPVVDLDAISAQSLRLVRSLLTLIALISVIFLWSEIHSAFS
FT                   FLENIHLWQVASTVQGVESMQPITLGSVLIAILVLIITTQLVRNLPALLELALLQHLDL
FT                   TPGTGYAVLTVTKYVLLLIGGLTGFSLIGIEWAKLQWLVAALGVGLGFGLQEIFANFIS
FT                   GLIILFEKPIRIGDTVTIRNLTGSITRINTRATTIADWDRKEIIVPNKAFITEQFINWS
FT                   LSDSVTRVVLTVPAPSEANSEEVTEILLNAAHRCSLVLDMPAPEAYLVDLQQGIQIFEL
FT                   RMHAAEMAHRMPLRHEIHQLILAGFREHGITLPFPPFQVRMETLHRAQNGNNATFTSSS
FT                   GSGRSGNSSRSPGDL"
     gtgcgcctga tccccgccct gctgatgagt ttactgctgt ccctgccatt gatggcgggt        60
     gcagccccga ctgaagatca gctcaaacag gagctgaaac aggcggaagc caacaaagaa       120
     atggccaatc agacgcaggt ggttgaggcg ctgcaaagcg cactcaactg gctgaatgaa       180
     gccagtgttt cagccgggcg cacggcggaa tatcaaaagg tcattgatga ctttccaaaa       240
     ctgacgcagg ccctgcgcca ggaattgcga aatcagcctg acaagccacc cgcgctggat       300
     aacagcatct cagccgctca gctcgagcag caaattctgc aagtcagcag ccagcaactg       360
     gaagaaaccc gccagttacg tcaggagcag gatcgttccc gtgacatcag cgactcacta       420
     agtctgatcc cgcaacagca atccgaagcc cgcaacgcgc tgagcgacat cgatcagcgc       480
     atacaggcgg cgacagcggc ggccacctcc tcacccctgg cgcaggcgca actcagcgcg       540
     cttcaggccg aatccgcagc gcgcaaagcg aaggtggatg aactggaact ggctcagctt       600
     tctgccaata accggcagga attgtcgcgg atgcgcaccg atctctacaa aaagcgcgcc       660
     gattttcttg atcagcaatt acaggtttta cgcaacacgc tgaataatca acgtcagcag       720
     gaagccgaac aggcgctgga aaaaaccgag ctgctggccg aacagagtgg cgagttgcca       780
     cactcgatca gtcagcagtt acaggcaaac cgcgagttgt cgctggcgct gaatcagcag       840
     gcgcagcgga tggacctgat ttcctctcaa caacgtcagg ccgctgcaca gactcagcag       900
     gtacgtcagg cgattaatac cattcgcgaa caggcgcagt ggcttggcgc gtctaattta       960
     cttggcgaaa ccctgagggc gcaggttgcg cgtctgccgg atatgccaaa accgcaacag      1020
     cttgaccgcg atatgggcca gttgcgcgtt cagcgtctgc actatgaaga tttgctggat      1080
     aagcaggcta tttaccgtca ggcgcggcag gacgatggca aaccgctcac cacagatcag      1140
     caaaaaattc tggatgcgca gttgcggacg caacgtgatt tgctcaattc cctgctctcg      1200
     ggttgcgata cccaaattct tgaactgacc aagctgaaag tggcaaacag ccaactggtg      1260
     gaggcgctga atgacgtaca tgacgccgcc caccgttatc tgttctgggt ggcagacgtc      1320
     agcgccatcg gcatttctta cccggtgcag gtcgcgcatg acctgaaacg gctggtctcg      1380
     ctggattcgc tcagccagct tggcggcgcg tcgatgatga tggtcaccag caaagaaaca      1440
     ctgttgccgc tgtttggcgc actgattctg gtgattatca gcatcagttc ccgcaagcac      1500
     tattatgcat ttctggaacg tgccagcagt aaagtcggca aagtcacgca ggatcatttc      1560
     tcgctgaccc tgcgtaccgt gttctggtca attctggtgg cgatgccgtt acctgtgctg      1620
     tgggccgcgc tgggattcgg gctgcaaagt gcctggccgt atccgattgc ggtggcgatc      1680
     ggcgatggcg tcaccgcgac gttgccaatc ctgtgggcgt ttatggtcag tgccgcgctg      1740
     gcacatcctc agggattgtt tgtggcacac ttcggctggc cgcagcgtgc ggtgtcaagg      1800
     gcactgcgct attacgcgct gtcgatctgg gtgctggtgc cgctcattat ggcgctgatt      1860
     accttcgata atctcaacga tcgcgagttc tctaatacgc tgggacgtct gtgcttcgtg      1920
     attctgtgtc tggtggtcgc actggtcacc aatagcctga aacgcgcggg cattccgctg      1980
     tatcacgata aaaaaggcaa cagcgaaaac atcattaaca agacgctgtg gtggatgctg      2040
     ctgggcgcac cgattgtcgc tgcgctggct tcactgatgg gctacctcgc gacctcacag      2100
     gcgctgctgg cccgcctgga aacctcggtc gccatctggt tcgtgttgct ggtgatttat      2160
     cacattatcc gccgctggat gctgattcag cgacgtcgta tcgccttcga acgcgccaag      2220
     cagcgccgtg cggaaatgct gaatcaacgc gcccgcggtg aggaagatgg ccatcagatc      2280
     agcaccagca atgaaggcac ggtcgagatt gaggaaccgg tggtggatct ggatgccatc      2340
     tctgcccagt cgctgcggct ggtgcgttct ctgctgacgt tgatcgcgct gatctcggtg      2400
     atcttcctgt ggtctgaaat ccactcggcc ttctctttcc tggaaaatat tcatctctgg      2460
     caggttgcgt ctacggttca gggggtggaa agcatgcagc cgatcaccct cggatcggtg      2520
     ctgatcgcca ttctggtgct gattatcacc acgcaactgg tgcgtaatct gcccgcattg      2580
     ctggaactgg cgctgctgca acacctggat ctgacgccgg gtaccggcta tgccgtactg      2640
     accgtcacca aatacgtatt gctgctgatt ggcggcctga ccggtttctc gctgatcggg      2700
     atcgagtggg caaaactgca atggctggtg gcggcactcg gtgtcggtct cggcttcggt      2760
     ttgcaggaga tcttcgctaa ctttatttcc ggcctgatta tcctgtttga aaaaccgatc      2820
     cgtatcggcg ataccgtaac gatccgcaac ctgaccggca gtatcaccag gatcaacacc      2880
     cgtgccacga cgatcgctga ctgggaccgc aaggagatta tcgtgccgaa caaggccttt      2940
     atcaccgagc agttcatcaa ctggtcgctg tcggattccg tcacgcgtgt ggtgctaacc      3000
     gtgcctgcac cgtcggaggc caacagtgaa gaagtgacag aaattctgct caacgctgcg      3060
     catcgctgtt cgctggtgct ggatatgcct gcgccggaag cctatctggt ggatctccag      3120
     caggggattc agattttcga gctgcgtatg catgccgctg aaatggcgca ccgtatgccg      3180
     cttcgccatg aaattcacca actgatcctg gctggattcc gcgagcacgg cattacactg      3240
     ccattcccgc cattccaggt gcgtatggaa acactgcacc gcgcgcaaaa tggcaataac      3300
     gcgaccttta ccagcagcag cggaagtggc cgcagcggaa acagttcgcg ctcaccgggc      3360
     gatttgtaa                                                              3369
//

If you have problems or comments...

PBIL Back to PBIL home page