(data stored in SCRATCH zone)

EMBL: CP002505.PE419

CP002505.PE419       Location/Qualifiers
FT   CDS_pept        454650..455117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0423"
FT                   /product="Uncharacterized protein family UPF0079, ATPase"
FT                   /note="PFAM: Uncharacterised protein family UPF0079,
FT                   ATPase; KEGG: spe:Spro_0427 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72052"
FT                   /db_xref="GOA:A0A0H3F5H6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5H6"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADW72052.1"
FT                   /translation="MNQLNISLPDEAATLQLGASLAKACEGSTVIHLYGDLGAGKTTFS
FT                   RGFLQALGHQGNVKSPTYTLVEPYQLEKIAVYHFDLYRLADPEELEFMGIRDYFAQDAI
FT                   CLVEWPQQGAGVLPEPDIELTLDYSLTGRTAKLVAVSESGIKLLHRVQQQG"
     atgaatcaac ttaatatctc tttacccgac gaagcggcaa cgttgcaact aggtgcttcc        60
     ctggcgaaag cctgtgaagg ttcaacggtt atccatcttt atggcgatct gggagccggt       120
     aaaacaacct ttagccgggg atttcttcag gcattagggc atcagggcaa tgtgaaaagc       180
     ccgacctaca cactggtcga gccttatcag ctggaaaaga ttgccgtgta tcattttgat       240
     ttatatcgcc ttgctgatcc ggaagaactg gagtttatgg ggatccgcga ttatttcgca       300
     caggacgcta tttgtctggt ggaatggcca cagcaggggg caggtgtgtt gccagaaccg       360
     gatattgaac tgacgctgga ttattccctg accggtcgca ccgcgaagct ggtggcggtt       420
     tctgaatctg gcataaaatt gctgcatcgt gttcaacagc aaggatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page