(data stored in SCRATCH zone)

EMBL: CP002505.PE422

CP002505.PE422       Location/Qualifiers
FT   CDS_pept        458835..459776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0426"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /note="TIGRFAM: tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; KEGG: spe:Spro_0430 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; PFAM: tRNA
FT                   isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72055"
FT                   /db_xref="GOA:A0A0H3F4D7"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4D7"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ADW72055.1"
FT                   /translation="MTDSENNALPPAIFIMGPTASGKTALAMSLLKHLPVELISVDSAL
FT                   IYRGMDIGTAKPTAEELAEAPHRLINILDPTVAYSAADFRRDALREMAEITSRNKIPLL
FT                   VGGTMLYFKALLEGLSPLPPADPVVRERIEKQAAEQGWEALHDQLRKIDPVAAMRIHPN
FT                   DPQRLSRALEVFFISGKTLTELTKISGETLPYRVHQFAIAPTRRELLHARIEERFSQML
FT                   SNGFEDEVRTLIARGDLHTDLPSIRCVGYRQMWSYLSGEFDYDEMVYRGVCATRQLAKR
FT                   QMTWLRGWESVEWLDSEKPEEALNRVIQVVSA"
     atgactgatt ctgaaaacaa cgcacttccc ccggcaatct ttattatggg gccgactgcc        60
     tccggtaaaa cagcattggc gatgtcgctg ctgaaacacc tgcctgtcga gcttatcagt       120
     gtcgattccg ccctgattta tcgcgggatg gatattggca cggcgaaacc cacggcagaa       180
     gagctggctg aagcaccgca ccggttgatt aatattcttg acccgacggt ggcttattcg       240
     gcggctgact ttcgtcgaga cgcattacgc gaaatggcag aaataacctc gcgcaataag       300
     atcccgttat tggtaggtgg gactatgctt tatttcaagg cattgcttga aggtctttcc       360
     cctttgccac ctgctgatcc tgtcgtgcgc gagcgtatcg aaaagcaggc tgcagaacag       420
     ggttgggagg cgttacatga ccagttgcgc aaaatagatc ccgttgcggc tatgcgaatt       480
     catccgaatg atccgcagag actgtccaga gcactggaag ttttttttat ttcgggtaaa       540
     actttaacgg aactgactaa aatttcgggt gaaacattac cctatcgcgt acatcagttt       600
     gcgattgcgc cgacccgccg ggaattatta catgcgcgga tcgaggaacg ttttagtcag       660
     atgttgtcca atggttttga agacgaagtc agaacgctga tagcccgggg cgatttgcat       720
     acagatttgc cttccattcg ttgtgtgggt tatcgccaga tgtggtcata tttgtctggt       780
     gaattcgatt acgatgaaat ggtttatcgt ggtgtttgcg cgacacgaca gctggccaaa       840
     cgtcagatga cctggttgcg aggttgggag agtgtcgaat ggctcgattc tgagaagcca       900
     gaagaggcct taaaccgtgt aattcaggtt gttagtgcat ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page