(data stored in SCRATCH zone)

EMBL: CP002505.PE460

CP002505.PE460       Location/Qualifiers
FT   CDS_pept        complement(498202..498672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0464"
FT                   /product="arginine repressor, ArgR"
FT                   /note="KEGG: ypb:YPTS_0489 arginine repressor; TIGRFAM:
FT                   arginine repressor; PFAM: Arginine repressor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72093"
FT                   /db_xref="GOA:A0A0H3F5A7"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5A7"
FT                   /inference="protein motif:TFAM:TIGR01529"
FT                   /protein_id="ADW72093.1"
FT                   /translation="MRNPAKQEDLIKAFKALLKEEKFSSQGEIVVALQDDGFENINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAEIGVPTTTSPLKNLVLDIDHNDAVVVIRTSPGA
FT                   AQLIARLLDSLGKSEGILGTIAGDDTIFTTPARGFSVKQLHDAILSLFEQEL"
     atgcgtaatc ctgctaaaca ggaagatttg atcaaagcct tcaaggcact gttgaaggaa        60
     gagaaattca gctctcaggg cgaaatcgtt gtcgcacttc aggatgatgg tttcgaaaat       120
     atcaatcagt caaaagtctc acggatgctg acaaaatttg gtgctgtcag aactcgtaat       180
     gcgaagatgg aaatggtgta ctgcctgccc gctgaaattg gcgtgccgac aaccaccagt       240
     cctctgaaga atcttgtgct ggatatcgac cataacgatg ccgttgtggt gatccgaacc       300
     agcccgggag ccgcacaact gatcgcgcgt ttactcgatt ccctgggtaa atccgaaggg       360
     atcctcggaa caattgccgg tgatgatacg atcttcacga caccggcccg cggatttagc       420
     gtcaaacagt tgcacgatgc gatcctcagt ttgttcgagc aggagctcta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page