(data stored in SCRATCH zone)

EMBL: CP002505.PE464

CP002505.PE464       Location/Qualifiers
FT   CDS_pept        complement(501465..502436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0468"
FT                   /product="Polyprenyl synthetase"
FT                   /note="KEGG: pwa:Pecwa_0792 octaprenyl diphosphate
FT                   synthase; manually curated; PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72097"
FT                   /db_xref="GOA:A0A0H3F5K9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5K9"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADW72097.1"
FT                   /translation="MNLEQIIDLTQDDMAAVNASILEQLNSEVSLINQLGYYIISGGGK
FT                   RIRPMIAVLAAKALSYQGDKHIKVAALIEFIHTATLLHDDVVDESDMRRGKATANAAFG
FT                   NAASVLVGDFIYTRAFQMMTDLESLPVLALMAKAVNVIAEGEVQQLINCNDPDITEASY
FT                   MQVIYSKTARLFEAASQASAMLAGGNNEQITALQDYGRYLGTAFQLIDDLLDYDADGET
FT                   LGKNTGDDLDEGKPTLPLLHAMQHGDAEQSAMIRKAIEEGNGRHLLEPVLAAMHQWGSL
FT                   AYTRQRAEEEADKAIQALQVLPESEYRSALEGLAHMSVKRDF"
     atgaacctag aacagattat tgatcttacc caggacgaca tggctgcagt caatgcatcc        60
     atccttgaac agttgaattc agaggtttct ctcatcaatc aactgggata ttacatcatc       120
     agtggcggcg gcaaacgtat ccgcccgatg atagcagtac tggcagccaa agcactatcc       180
     taccagggcg ataaacacat caaagtcgct gctctgattg agtttattca taccgccaca       240
     ctgttacatg acgatgtggt tgacgaatca gatatgcgtc ggggaaaggc cactgcgaac       300
     gccgcatttg gcaacgccgc cagcgtattg gtcggcgatt ttatctacac ccgcgcattt       360
     caaatgatga cagatcttga atcgcttcct gttctggctc tgatggcaaa agcggtgaat       420
     gtgattgcag aaggcgaagt gcagcaactg attaattgca atgatcctga catcacagaa       480
     gccagttaca tgcaggtgat ttacagcaaa actgcgcgtc tttttgaagc cgcgtcgcaa       540
     gcctctgcca tgctggcggg cggaaacaat gagcagatta cagctttgca agattatggt       600
     cgttatctgg gcaccgcttt ccagctgatt gatgatttgc tcgattacga tgctgatggc       660
     gaaacgctgg gcaaaaacac tggcgatgac cttgatgaag gaaaaccgac gttgcccctt       720
     ctgcatgcga tgcagcacgg tgatgccgaa caatccgcta tgatccgcaa agctatcgaa       780
     gaaggtaacg ggcgccattt attggaaccc gtgctggcag caatgcatca gtggggctct       840
     ctggcttaca cccgccagcg tgctgaagaa gaagctgata aagccatcca ggcgcttcag       900
     gtgctcccgg agtccgaata tcgctctgcg cttgaaggcc tcgcgcatat gtctgtaaaa       960
     cgcgatttct ga                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page