(data stored in SCRATCH zone)

EMBL: CP002505.PE469

CP002505.PE469       Location/Qualifiers
FT   CDS_pept        505660..506982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0473"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dda:Dd703_2863 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72102"
FT                   /db_xref="GOA:A0A0H3FBL7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FBL7"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADW72102.1"
FT                   /translation="MELSQALGIINLTAPDEVQSLADLLSPDLIQQAFSLTDTVTLRKR
FT                   KLPLESMVWLVIGMAIFNNKPMSHIVNLMDIVDRTGRSFTAPSSVIARRKTLGEDAIRV
FT                   LFDITQQHWHAEAKHPLWHGLTLNAVDGVVWHTQDTPENAEAFGKASNQHGERGYPQVR
FT                   MVCLMELSSHLLRASVMDSYDVNEMRLAAQLADSAPDNSITLFDKGFYSLGLLHDWHNA
FT                   GENRHWLTPLKKNTQYEVVCKLGKQDELIRLKTSPQARKQWEGLPEEMTVRLIRRKVNG
FT                   VERQVLTSMTDAMRYPAASVAELYKHRWEIELGYREAKQFLLGNRWALRSKLPEMVRQE
FT                   LWGILLTYNLIRYQMIKMAFSLKGDYLPYQLSFSGAVSEILRLLIGLPWASAGAIPGHL
FT                   KHFYSNSAMLKLPSRREREYAREVREKRSKYPLKNNAGHLK"
     atggaacttt cacaagctct cggtattatc aatctcactg cccccgatga agttcaaagc        60
     ctcgctgacc tcctgtctcc tgacctcatt cagcaagctt tttctctcac tgacaccgtc       120
     accctacgca agcgtaaact ccccctcgag tccatggtct ggctggttat cggcatggcc       180
     atattcaaca ataagcctat gagtcatatc gttaatctga tggatattgt tgaccgaacc       240
     ggacgctcat tcaccgcacc cagctccgtt attgcccgca gaaaaacgtt aggtgaagat       300
     gccatccggg ttctgtttga tatcactcag caacactggc atgcagaggc aaaacatcct       360
     ctctggcacg gactgacact caatgccgtc gatggcgtag tctggcatac gcaggacaca       420
     cctgaaaatg cagaggcctt cggtaaggct tcgaaccagc acggcgaacg cggatatcct       480
     caggtccgca tggtctgcct gatggaactg agcagtcacc tgttgcgggc cagtgtgatg       540
     gacagttacg acgtgaacga gatgcgcctg gcggcacagc tggcagacag cgcgccggat       600
     aacagtatta cgctgttcga taagggtttt tactctttag gcctgctaca tgactggcat       660
     aatgcgggcg aaaatcgcca ctggctgacg ccgctgaaaa agaacacgca gtacgaggtg       720
     gtgtgtaagc tcggcaaaca ggacgagctg atacggctga aaacgtcacc gcaggccaga       780
     aaacagtggg aaggactgcc ggaagaaatg accgtgcggc ttatccgccg gaaggtcaat       840
     ggcgttgaac ggcaggttct gacgtcaatg acggatgcga tgcgttatcc ggccgccagc       900
     gtggcggagc tttataagca tcgctgggaa atcgagttag gataccggga ggctaagcag       960
     tttttactgg ggaaccggtg ggcgctgaga agcaaactgc cggaaatggt caggcaggaa      1020
     ctgtggggta tcctgctgac ttataacctt attcgttacc agatgatcaa gatggcgttc      1080
     agcctgaagg gagattacct gccttatcag ctgagtttta gcggggcagt gtcggagata      1140
     ttacggttat taatcgggct gccgtgggca tcagcgggag ccatcccggg tcatctgaag      1200
     catttttaca gcaactcagc gatgttaaaa ctgccctcga ggcgtgagcg tgaatatgcg      1260
     agggaagtga gagaaaaaag gtcgaaatat cccttaaaaa acaatgccgg tcaccttaag      1320
     tga                                                                    1323
//

If you have problems or comments...

PBIL Back to PBIL home page