(data stored in SCRATCH zone)

EMBL: CP002505.PE476

CP002505.PE476       Location/Qualifiers
FT   CDS_pept        512340..514292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0480"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: spe:Spro_0483 ATP-dependent
FT                   metalloprotease; PFAM: peptidase M41; AAA ATPase central
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72109"
FT                   /db_xref="GOA:A0A0H3F825"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F825"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADW72109.1"
FT                   /translation="MSDMAKNLILWLVIAVVLMSVFQSFGPSESNGNKVDYTTFTTEVA
FT                   QDQVREVRINGRAIDVIKKDSSKYTTYIPVNDPKLLDTLLSKNVKVVGEPPEQQSFLAT
FT                   IFISWFPMLLLIGVWIFFMRQMQGGGGKGAMSFGKSKARMLTEDQIKTTFADVAGCDEA
FT                   KEEVSELVDYLREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGS
FT                   DFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQM
FT                   LVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRR
FT                   VPLATDVDASVIARGTPGFSGADLANLVNEAALFSARGNKRVVSMVEFEKAKDKIMMGA
FT                   ERRSMVMTESQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIPRGRALGVTFFLPEGDAI
FT                   SASRQKLESQISTLYGGRLAEEIIYGVEKVSTGASNDIKVATSIARNMVTQWGFSDKLG
FT                   PLLYAEEEGEVFLGRSVAKAKHMSDETARIIDQEVKSLVERNYVRARTLLMENMDILHS
FT                   MKDALMKYETIDAPQIDDLMNRTEVRPPAGWDDANGKNGNSSSNDGGTPKAPTPVDEPR
FT                   TPNPGNTMFEQFSGK"
     ttgagtgaca tggcgaagaa cctgatcctc tggttagtca tcgcggttgt attgatgtct        60
     gtatttcaga gttttggtcc cagcgaatct aatggtaaca aggtagatta cactaccttt       120
     acaaccgaag tggcccaaga ccaggtccgt gaagtacgta tcaatggacg tgcgattgac       180
     gttatcaaaa aagacagcag caaatacaca acctatattc cggttaatga tcctaaattg       240
     ctggatacgc tgctgagcaa aaacgtgaaa gttgttggtg aaccgcctga acagcagagt       300
     ttcctggcga ctatcttcat ttcatggttc ccgatgctgc ttctgattgg cgtctggata       360
     ttctttatgc gacagatgca gggtggcggt ggcaaaggcg caatgtcctt tggtaaaagc       420
     aaagcccgca tgctgacgga agaccaaatc aaaactacgt ttgctgacgt tgcaggttgt       480
     gacgaagcga aggaagaggt gagcgagctg gttgattacc tgcgtgaacc aagccgtttc       540
     cagaaactgg gcggtaaaat tcctaaaggc gttctgatgg tgggtcctcc gggtacgggt       600
     aagaccttgc tggctaaagc cattgccggt gaagccaaag tcccgttctt tacgatttcg       660
     ggttctgact tcgttgaaat gttcgtcggt gtgggtgcat cacgtgtccg tgatatgttc       720
     gaacaggcga agaaagcggc tccatgtatc atcttcatcg atgaaattga tgccgttggc       780
     cgtcagcgtg gtgcaggttt aggcggtggt catgatgaac gtgagcaaac cctgaaccag       840
     atgctggttg agatggatgg tttcgaaggt aacgaaggta ttatcgttat tgccgcgacc       900
     aaccgtccgg atgttctgga ccctgcgttg ctgcgtccgg gccgttttga ccgtcaggtt       960
     gttgtcggct tgccagatgt ccgtggccgt gaacagatcc tgaaagttca catgcgtcgt      1020
     gttccgctgg cgacagatgt tgatgcttct gtgattgccc gtggtacacc aggattctct      1080
     ggtgctgacc tggctaacct ggtcaacgaa gctgcactgt tctctgctcg tggtaacaaa      1140
     cgtgtggtgt cgatggtcga gttcgaaaaa gccaaagaca aaatcatgat gggtgctgag      1200
     cgccgttcca tggtaatgac cgaatcgcag aaagagtcca ctgcatatca cgaagcggga      1260
     cacgccatca ttggccgtct ggttcctgaa catgacccag tgcacaaggt gaccattatc      1320
     cctcgtggcc gtgcattagg tgtgactttc ttcctgcccg aaggtgatgc gatcagcgcc      1380
     agccgtcaga aactcgaaag tcagatttct accttatatg gtggccgtct tgctgaagag      1440
     attatttacg gtgtggaaaa agtgtctacc ggtgcgtcta acgatatcaa agtagccacg      1500
     tcgattgccc gtaacatggt tacgcagtgg ggcttctcag ataaattagg tccgttgctg      1560
     tatgcggaag aagaaggtga agtcttcctc ggtcgttcag tcgcgaaagc taagcatatg      1620
     tctgatgaaa ccgcccgtat catcgatcag gaagttaagt ctctggttga acgtaactac      1680
     gttcgtgcgc gtactttgct gatggaaaac atggatatcc ttcattcaat gaaagatgcc      1740
     ctgatgaagt atgaaaccat cgatgcaccg caaattgatg acctgatgaa ccgtactgaa      1800
     gttcgcccgc cagctggctg ggacgatgct aacggcaaaa acggtaacag cagctccaat      1860
     gacggcggta cgccaaaagc gccaacgcct gtcgacgaac ctcgtacgcc gaatcctggc      1920
     aacacgatgt ttgagcaatt cagcggcaag taa                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page