(data stored in SCRATCH zone)

EMBL: CP002505.PE489

CP002505.PE489       Location/Qualifiers
FT   CDS_pept        531229..532203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0494"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   spe:Spro_0499 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72122"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5N5"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADW72122.1"
FT                   /translation="MSKRILLTLLLVAVAVSLAVLFRAHNQDLLLQGEVDAPEVIVASK
FT                   AKGRVIERHVERGDDVKAGQLLITLDSPELMAQLRAAEAARDQAKAQLDLSVNGTREES
FT                   IRNLKASLAQSQAEYINARDLYNRNAQVATKGFISASDLEDSRRARDSAYQQVLVAKAN
FT                   LDEGVNGDRVEQRESYAAQLRQAEEDLLEVKAQTDDLQVKAPVDGEVGPVPVEVGELQN
FT                   ASSPLLTLVRLPDAYFVFNLREDILAGVRKGDKVQMRVPALNNQMIEAEVRYIAPLGDY
FT                   ATKRATRATGDFDLKTFEVRLYPAKPVPGLRQGMSALWQWKAK"
     atgagtaaac gaattttatt gaccctcctg ctggtcgccg ttgcggtttc tctggcggtg        60
     ctgtttcggg cgcacaatca ggatctcttg ttacagggcg aagttgacgc gccggaagtg       120
     attgtggcgt cgaaagctaa gggccgcgtc atagaacgcc atgtggaacg cggcgacgat       180
     gtcaaagccg ggcagctatt gatcaccctc gacagccccg agctgatggc gcagttgcgc       240
     gcggccgaag cggcgcgcga tcaggcaaaa gcccagcttg atctttccgt taacggcacc       300
     cgtgaagaaa gtatccgtaa cctgaaagcc tcgctggcgc agtcgcaggc ggaatacatt       360
     aatgcacgtg atctttataa ccgtaatgcc caagtggcga ccaaaggctt tatttctgct       420
     tctgatttag aagattcccg ccgtgcccgc gacagtgctt atcagcaggt attagtcgcc       480
     aaagctaatc tggatgaagg cgtcaacggc gaccgcgttg agcaacgcga aagctatgcc       540
     gcccagttgc gtcaggcgga agaagatctg ctggaagtga aagcgcaaac cgatgatttg       600
     caggttaaag caccggttga tggtgaagtc gggccagttc ccgtggaagt cggcgagctg       660
     caaaatgcct cgagtccgtt actgacgtta gttcgtctgc ctgatgcgta tttcgtgttt       720
     aacctgcggg aagatattct ggcgggcgtg cgtaaaggcg ataaagtcca gatgcgcgtt       780
     ccggcgctga ataaccagat gatcgaagct gaagtgcgct acattgcacc gctcggcgat       840
     tatgcgacca aacgtgccac gcgtgcgacc ggcgactttg atttaaaaac ctttgaagtg       900
     cgtctgtacc ctgcgaaacc ggtgcccgga ttacgacagg gcatgagcgc gttgtggcaa       960
     tggaaagcta agtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page