(data stored in SCRATCH zone)

EMBL: CP002505.PE493

CP002505.PE493       Location/Qualifiers
FT   CDS_pept        complement(535478..536473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0498"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: cko:CKO_04553
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72126"
FT                   /db_xref="GOA:A0A0H3FAR3"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAR3"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADW72126.1"
FT                   /translation="MELLCPAGNLPALKAAIDNGADAVYIGLKDDTNARHFAGLNFTEK
FT                   KLQEAASYVHRHRRKLHIAINTFAHPDGYQRWERAVDMAAQLGADALILADLAMLDYAA
FT                   NKYPHVERHVSVQASATNDEAIRFYKRNFDVARVVLPRVLSMHQVRQLSRTTVVPLEVF
FT                   AFGSLCIMAEGRCYLSSYLTGESPNTVGACSPARFVRWQQTAQGMESRLNDVLIDRYEE
FT                   GENAGYPTLCKGRYLVDGAKYHALEEPTSLNTLELLPELFAANIASVKIEGRQRSPAYV
FT                   SQVARVWRAAIDRCMADPQNFKTDEAWMNTLGSMSEGTQTTLGAYHRKWQ"
     atggagctac tttgcccggc aggaaattta cctgcgctga aagcggcaat cgacaatggc        60
     gctgatgcgg tttatatcgg cctgaaagat gacaccaatg cgcgccattt cgccggcctg       120
     aattttacgg aaaaaaagct gcaggaagcc gccagttatg ttcaccgcca ccgccgtaaa       180
     ctgcatatcg ccatcaatac gtttgcacat cctgacggct atcagcgctg ggaacgcgcg       240
     gtggatatgg cggcacaact cggcgctgat gcgctgattc tggcagatct ggcgatgctg       300
     gattacgcgg cgaataaata tccccacgtt gagcgccatg tgtcggtgca ggcttccgcc       360
     accaatgacg aagccattcg tttttataaa cgcaactttg atgtcgcccg tgtggtattg       420
     ccgcgtgtgc tttccatgca tcaggtgcgt cagctttccc gtactaccgt tgtgccgctg       480
     gaagtgttcg cgttcggcag tttgtgcatt atggccgaag gccgctgcta tctttcgtct       540
     tatctgaccg gtgaatcgcc aaataccgtc ggtgcctgtt ctccggcgcg gttcgtgcgc       600
     tggcaacaga ccgcacaggg catggaatca cggctgaatg atgtcctgat cgaccgttat       660
     gaagaaggcg aaaacgccgg ttatccgacg ttgtgcaaag gtcgttatct ggtggatggc       720
     gcgaaatacc atgcgctgga agaaccgacc agcctgaata cgctggaatt attaccggaa       780
     ctgttcgccg cgaatattgc ctcggtgaaa attgaaggac gccagcgcag cccggcgtac       840
     gtcagccagg tcgcgcgcgt atggcgtgcg gccatcgacc gctgtatggc cgatccgcaa       900
     aacttcaaaa ccgatgaagc ctggatgaac acgctgggtt ccatgtctga gggcacacaa       960
     acgacgctcg gtgcctatca ccgcaagtgg cagtaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page