(data stored in SCRATCH zone)

EMBL: CP002505.PE496

CP002505.PE496       Location/Qualifiers
FT   CDS_pept        complement(537848..538150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0501"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: yen:YE0453 GIY-YIG nuclease superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72129"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR022992"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F847"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ADW72129.1"
FT                   /translation="MPTAANWFLYMLRTPTGMLYTGITTDVQRRLGQHQSGKGAKSLRG
FT                   KGELQLAFQCPAGDRSLASKLEIKVKKLSKAQKELLVRNAPECLENYLGLAESGK"
     atgcccaccg ccgccaactg gtttttatat atgctgagaa cccccaccgg gatgttgtat        60
     accggcatca cgacagacgt gcagcggcgt ctcggccagc atcagtcggg taaaggggcg       120
     aaatcgttgc gtggaaaagg ggaattacag ctggcattcc agtgccctgc gggtgaccgc       180
     tcgctggcat caaagctgga aataaaagtc aaaaaactga gtaaggcaca gaaagagctg       240
     ctggtgagaa acgcgccgga atgcctggaa aattatctgg gattagcgga aagcgggaaa       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page