(data stored in SCRATCH zone)

EMBL: CP002505.PE498

CP002505.PE498       Location/Qualifiers
FT   CDS_pept        538806..539447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0503"
FT                   /product="Semialdehyde dehydrogenase NAD-binding protein"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   KEGG: spe:Spro_0511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72131"
FT                   /db_xref="GOA:A0A0H3FAR8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAR8"
FT                   /inference="protein motif:PFAM:PF01118"
FT                   /protein_id="ADW72131.1"
FT                   /translation="MAKALLLGGSGLIGRELLRLLQLDPRVSRIVAPSRRPLPPGNKLI
FT                   NPLGANLTSLVVALDEPIDLLFCCLGTTRKQAGSAQAFRAVDYDLVVDCAKAARELGAR
FT                   HCLAVSAHGADAHSRFLYNRTKGEMELTLMQQGWPLLTLVRPSLLVGQRHPPRLLEQLS
FT                   APLFKMLPGKWKAVESDVVAKALQEQAFNAGLGGITVLESDQIAASIEEL"
     atggcaaaag ctcttctgct gggtggaagc gggctgatcg ggcgggagct tttacgcctg        60
     ctgcaactgg atccacgtgt cagccgtatt gtcgcgccga gccgccgtcc gctaccaccg       120
     ggcaataaac tgattaatcc gctgggcgcg aatctgacct cgctggttgt cgcactcgat       180
     gaaccaattg atttgctgtt ctgctgcctg gggaccacgc gtaaacaagc gggcagtgca       240
     caggcatttc gggcagtcga ttacgatctg gtggtcgatt gcgccaaagc agcacgggag       300
     ctgggcgcac gtcattgtct ggccgtcagc gcccacggtg cggatgcgca ttcgcgtttc       360
     ctctataacc gtaccaaagg ggaaatggaa ctgacgctga tgcagcaggg ctggccgttg       420
     ctcacgctgg tcaggccgtc tctgttggtt ggccagcgtc atccgccgcg cctgctcgaa       480
     caactgagtg cgccgttatt caaaatgctg ccaggaaaat ggaaagccgt tgagtctgat       540
     gtcgtggcaa aagccttgca ggaacaggca tttaacgccg gtctgggcgg gatcaccgtg       600
     ctggaatccg atcagattgc cgccagcatt gaagaacttt aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page