(data stored in SCRATCH zone)

EMBL: CP002505.PE503

CP002505.PE503       Location/Qualifiers
FT   CDS_pept        complement(542713..543504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0508"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnK;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; KEGG: spe:Spro_0517 phosphonate
FT                   C-P lyase system protein PhnK; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72136"
FT                   /db_xref="GOA:A0A0H3FAS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAS1"
FT                   /inference="protein motif:TFAM:TIGR02323"
FT                   /protein_id="ADW72136.1"
FT                   /translation="MNTPLNLAAEPLLSVNNLTHLYAPGKGFCDVSFNLYPGEVLGIVG
FT                   ESGSGKTTLLQSISARLAPQEGQVIYNNGQTTAQSLYDMPESDRRRLLRTDWGVVHQHP
FT                   MDGLRRQVSAGGNIGERLMAVGERHYGDIRKKAGQWLEDVEIPVSRIDDLPTTFSGGMQ
FT                   QRLQIARNLVTHPRLVFMDEPTGGLDVSVQARLLDLLRTLVVEMQLAVVIVTHDLGVAR
FT                   LLAHRLLVMKQGQVVESGLTDRVLDDPHHPYTQLLVSSVLS"
     atgaacactc cgttaaatct cgccgccgaa ccgctgctgt cggtgaataa cctgacccat        60
     ctttatgcgc cgggtaaagg cttttgcgat gtgtcattca atctgtatcc cggtgaagtg       120
     ctgggtattg tcggcgaatc cggttccggc aaaaccacgc tgttgcagtc gatttccgcc       180
     cgtcttgcgc cgcaggaagg acaggtcatc tacaacaacg gccagaccac tgcgcagtca       240
     ctgtacgaca tgccagaaag tgaccgccgc cgcctgctgc gcactgactg gggcgtggtg       300
     catcagcatc cgatggacgg cttgcgccgc caggtttctg ccggtggcaa tatcggcgag       360
     cgtctgatgg cggtcggtga acgtcattac ggcgatatcc gcaagaaagc cggtcagtgg       420
     ctggaagatg tcgaaatccc ggtttcacgt attgatgacc tgccgactac gttttcgggt       480
     gggatgcagc aacgtctgca aatcgcccgc aatctggtga cgcatccgcg tctggtgttt       540
     atggatgaac cgaccggtgg cctggacgtg tccgttcagg cgcgtctgct ggatctgctg       600
     cgcacgctgg tggtggaaat gcagctggcg gtggtgattg tcacccatga cctcggcgtt       660
     gcccgcctgc ttgcacaccg tttgctggta atgaagcaag gtcaggtggt ggaaagtggt       720
     ttaaccgacc gcgtgctcga cgatccgcat catccatata cgcagctgct ggtttcttcc       780
     gtgctgtcct ga                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page