(data stored in SCRATCH zone)

EMBL: CP002505.PE508

CP002505.PE508       Location/Qualifiers
FT   CDS_pept        complement(546480..547205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0513"
FT                   /product="phosphonate C-P lyase system transcriptional
FT                   regulator PhnF, GntR family"
FT                   /note="TIGRFAM: phosphonates metabolism transcriptional
FT                   regulator PhnF; PFAM: UbiC transcription
FT                   regulator-associated domain-containing protein; regulatory
FT                   protein GntR HTH; KEGG: spe:Spro_0522 phosphonate
FT                   metabolism transcriptional regulator PhnF; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72141"
FT                   /db_xref="GOA:A0A0H3FAS4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3FAS4"
FT                   /inference="protein motif:TFAM:TIGR02325"
FT                   /protein_id="ADW72141.1"
FT                   /translation="MNLSRHPTSHARVYQQIAAELEQELRNGYRCGDYLPPEQQLAERF
FT                   QVNRHTLRRAVDELVDRGWLQRRQGIGTLVLMRPYDYPLHSQARFSQNLLDQGSHPTSE
FT                   RLLAVLRPATDHVAAALSRQEGDTIIHLRTLRRVNGVPVCVIDHYLPDLDWWPALQNFH
FT                   NGSLHDFIREEIKQKLSRRTTRINARRALAKESKLLEIVPQAPLLCVRTLNICEGSDTV
FT                   AEYSVSLTRADMIELTMEH"
     atgaacttat ctagacatcc gaccagtcac gccagggtgt atcagcaaat cgctgccgag        60
     ctggaacagg aactgcgtaa cggttaccgc tgcggcgatt atctgccgcc ggaacaacaa       120
     cttgccgaac gttttcaggt aaatcgccat acgctgcgcc gtgcggtgga tgaactggtg       180
     gatcgcggct ggctgcaacg caggcagggc attggcacgc tggtgctgat gcgtccttac       240
     gattatccgc tgcattcgca ggcgcggttc agccagaacc tgctggatca gggcagccat       300
     ccgaccagcg aacgtctgct ggcggtgctg cgcccggcga ccgatcacgt cgcggcggcg       360
     ctgtcacgtc aggaaggcga cacaattatt cacctgcgta cgctgcgccg cgttaacggc       420
     gtgccggtct gtgtgattga ccactatttg cccgatctcg actggtggcc tgcattgcaa       480
     aatttccata acggctcgct gcacgatttt atccgtgaag aaattaagca aaagctcagc       540
     cgccgcacca cccgcatcaa tgcccgccgc gcgctggcaa aagagagcaa attactcgaa       600
     atcgtcccgc aggcaccgct gctgtgtgtc cgcaccctga acatttgtga aggcagcgat       660
     acggtggcgg aatactccgt cagcctgacg cgcgccgaca tgatcgaact gaccatggag       720
     cactga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page