(data stored in SCRATCH zone)

EMBL: CP002505.PE515

CP002505.PE515       Location/Qualifiers
FT   CDS_pept        complement(553059..554477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0520"
FT                   /product="PTS system, trehalose-specific IIBC subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, trehalose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; KEGG:
FT                   spe:Spro_0529 PTS system trehalose(maltose)-specific
FT                   transporter subunits IIBC; PFAM: phosphotransferase system
FT                   EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72148"
FT                   /db_xref="GOA:A0A0H3F5F9"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5F9"
FT                   /inference="protein motif:TFAM:TIGR01992"
FT                   /protein_id="ADW72148.1"
FT                   /translation="MSKVKQQDVDQLIALVGGSDNIAMVTHCITRLRFVLNDPSKADPK
FT                   GLEALPMVKGCFTNAGQFQVVIGPEVDDYYKVLIASTGKSAAGKEQAKVAARQNMSWFE
FT                   RSISHFAEIFFPLLPALISGGLILGFRNVIGEIPMSGGQTLAQMHPLWQSIYDFLWLLG
FT                   EAVFMFLPVAVCWSTVRKMGGTEILGIVLGITLVSPQLMNSYNLGQQIPEVWNFGWFTI
FT                   EKVGYQAQVIPSVLAGMALAMIENGLKRIVPNYLYLVIVPVSSLIIAVFLAHTLIGPFG
FT                   RMVGDGVAFAVKFIMTGSLAPIGAALFGFLYAPLVITGVHQTTLAIDMQMVQSTGGTPV
FT                   WPLIALSNIAQAAAVVGVIIVSRKHNEREISVPAAISAFLGVTEPAMYGINLKYRFPML
FT                   CAMIGSAGAGLICGLFHVTANGIGVGGLPGILSIKPQFWSIYALAMLVAIVVPIILTVL
FT                   VYQRKARRGELAVV"
     atgagcaaag ttaagcaaca ggatgttgat cagctgatcg ccctcgttgg cggcagcgac        60
     aatatcgcga tggtgactca ctgcattacg cgtcttcgtt ttgtcctcaa tgacccgtcc       120
     aaagccgacc cgaaaggtct cgaagccctg ccgatggtca aaggctgctt caccaacgcc       180
     ggtcagttcc aggtggttat cgggccggaa gtggatgatt actacaaagt tctgatcgcc       240
     agcaccggta aaagtgcggc cggaaaagaa caggcaaaag ttgccgcccg ccagaatatg       300
     agctggtttg agcgcagcat ttctcacttt gcggaaatct ttttcccgct gttaccggcg       360
     ctgatcagcg gcggtttaat tctcggtttc cgcaatgtta tcggcgaaat tccgatgagc       420
     ggcggccaga cgctggcgca gatgcacccg ctgtggcaat ccatttacga cttcctctgg       480
     ctgcttggcg aagccgtgtt tatgttcctg ccggtggcgg tgtgctggtc gacggtcaga       540
     aaaatgggcg gcaccgaaat cctcgggatt gtgcttggca taacgctggt atcgccgcaa       600
     ctgatgaact cctacaacct cgggcagcaa atccctgaag tatggaattt cggctggttc       660
     accatcgaaa aggtcggtta tcaggcgcag gtcattcctt ccgttctcgc cggtatggcg       720
     ctggcgatga tcgaaaatgg cctgaaacgc atcgtgccta attatctgta tctggtgatt       780
     gtgcccgtca gctcgctgat tattgccgta ttcctggcgc atacgctgat cgggccgttt       840
     ggccgcatgg tgggcgacgg cgtggctttc gcggtgaaat tcatcatgac cggcagcctc       900
     gcacccatcg gtgccgcgct gtttggtttc ctctatgcgc cactggtcat caccggcgtg       960
     catcagacca cccttgccat cgacatgcag atggtgcaaa gcaccggcgg aaccccggtg      1020
     tggccgctga tcgccctgtc caatattgcg caagccgctg cggtcgtcgg cgtgattatc      1080
     gtcagccgca aacataatga gcgcgagatc tccgtgcccg cagcgatatc cgcgttcctc      1140
     ggcgtaaccg aaccggcgat gtacggcatc aacctgaaat accgcttccc gatgctgtgc      1200
     gcaatgattg gctcggccgg tgccggcctg atttgcggcc tgttccacgt cacggccaac      1260
     ggcatcggcg tcggcggctt accgggtatt ttgtccatca aaccgcagtt ctggagtatt      1320
     tacgcactgg ccatgctggt ggcgatcgtg gtgccgatta tcctgaccgt gctggtttat      1380
     cagcggaaag cccgccgggg tgaactggca gtggtgtaa                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page