(data stored in SCRATCH zone)

EMBL: CP002505.PE522

CP002505.PE522       Location/Qualifiers
FT   CDS_pept        562442..563593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0527"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: spe:Spro_4312 rRNA
FT                   (guanine-N(2)-)-methyltransferase; PFAM: methyltransferase
FT                   small"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72155"
FT                   /db_xref="GOA:A0A0H3F4M9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M9"
FT                   /inference="protein motif:PRIAM:2.1.1.52"
FT                   /protein_id="ADW72155.1"
FT                   /translation="MSQFETETGGQLLQLRLERYPLEEAATQLQAWEAADEYLLQNLNT
FT                   DALNGRPLLIFNDAFGTLACALQPHNPTSVNDSFMSQLAMRHNLRLNGFDEDSVAAQSS
FT                   LVPLPINPGLVIIKVPKTLALLEQQLLALREVVTPDTQIIAGAKARDIHTSTLQLFEKI
FT                   LGPTKTSLAWKKARLIHCEATLPAQTAEPVISEWALDDSEFRISNHANVFSRGGLDVGA
FT                   RFFMQHLPEGIEGRMADLGCGNGVIGMTALALNPDAEMLFVDESYMAVESSRINVENNL
FT                   PQDVSRCHFEVNNMLAGVERETLHAVLCNPPFHQGTVISDDTAWRMFCDAKRCLQTGGE
FT                   LRIVGNRHLDYYQKLRRLFGNCTTIATNQKFVILRAVKTAAHH"
     atgagccaat ttgaaaccga aaccggtggt cagttattgc aactgcgtct ggaacgttat        60
     ccgctggaag aagcggcaac gcagttacag gcatgggaag cggccgatga atatctgctg       120
     caaaacctga acaccgacgc gctcaacggc cgtccgctgc tgattttcaa cgatgctttc       180
     ggcacgctgg cctgcgcctt gcagccgcac aacccgacca gcgtcaacga ctccttcatg       240
     agtcagctgg cgatgcgcca caacctgcgc cttaacggtt ttgacgaaga cagcgtggcg       300
     gcgcaaagca gcctggtgcc gttgccgatc aatccgggtc tggtgatcat caaagtgcca       360
     aaaacgctgg cactgctgga acaacaactg ctggcgctgc gtgaagtggt gacgccggac       420
     acgcagatta tcgccggcgc gaaagcccgt gatattcaca cgtcaacgtt gcaactgttc       480
     gagaaaatcc tcggaccgac caaaaccagt ctggcgtgga aaaaagcccg tctgatccat       540
     tgtgaagcca ccttgcctgc gcaaaccgca gagccggtga tttctgagtg ggcgctggat       600
     gacagtgaat tccgtatttc caaccacgcg aacgtgttct cacgcggcgg tctggatgtc       660
     ggcgctcgct ttttcatgca acatctgccg gaaggcattg aagggcgcat ggcggatctg       720
     ggctgtggta acggtgtgat cggcatgacc gcactggcgc tgaaccccga tgcggaaatg       780
     ctgttcgtcg atgaatctta tatggcggta gaatcgagcc gtattaacgt cgaaaacaat       840
     ttgccgcagg atgtcagccg ctgtcatttc gaagtgaaca acatgctggc cggtgtcgag       900
     cgcgaaacac tgcacgccgt gctgtgtaac ccgccgttcc atcagggcac ggtcatcagc       960
     gatgacaccg cgtggcgcat gttctgcgat gccaaacgct gcctgcaaac cggcggcgag      1020
     ctgcgtatcg tcggcaaccg tcatctggat tactaccaga agctgcgtcg cctgttcggc      1080
     aactgcacga cgatcgccac caatcagaaa ttcgtgattt tgcgtgccgt gaaaacggct      1140
     gcacatcatt ga                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page