(data stored in SCRATCH zone)

EMBL: CP002505.PE534

CP002505.PE534       Location/Qualifiers
FT   CDS_pept        complement(584214..585413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0539"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ebi:EbC_44680 maltose/maltodextrin-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72167"
FT                   /db_xref="GOA:A0A0H3F5V2"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5V2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADW72167.1"
FT                   /translation="MTLSIKKIVKHTLALSALATLVLSSSAFAKIEEGKLVIWINGDKG
FT                   YNGLAEVGKKFEKDTGIKVTVEHPDKLEEKYPQVAATGGGPDIIFWAHDRFGGYAQSGL
FT                   LAEISPDQTFKDKLFPFTWDAVTFNGKLIGYPVAVEALSLIYNKDIIKEAPKTWEEIPA
FT                   LDKELRATGKSAIMWNLQEPYFTWPIIAADGGYAFKYENGKYNIKDTGVNNAGSQAGLQ
FT                   FIIDLVKNKHINADTDYSIAEAAFNKGQTAMTIDGPWAWSNLDKSKINYGVTLLPTFHG
FT                   KPSKPFVGVLTAGINAASPNKELAKEFLENYLITDDGLAVVNKDKPLGAVALKSYQEKL
FT                   EKDPRIAATMANSKNGEIMPNIPQMSAFWYAERSAIINAVNGRQTVPQALKDVETRITK
FT                   "
     atgaccctca gcattaaaaa gattgttaaa cacacactgg cactctcggc gctggctacg        60
     ctggtgttgt catcttccgc gttcgccaaa atagaagaag gaaagctggt catctggatc       120
     aacggtgaca agggctataa cggcctggcg gaagtcggta agaaatttga aaaagacacc       180
     ggcattaaag tcacggtaga acatccggac aagctggaag aaaaataccc gcaagtggca       240
     gccacaggcg gcggccctga catcatcttc tgggcgcatg accgttttgg cggctacgca       300
     caatccggtc tgctggctga aatcagcccg gaccagacct tcaaagacaa actgttcccg       360
     ttcacctggg atgcggtcac cttcaacggc aagctgatcg gctatccggt cgcggttgaa       420
     gcgctgtcac tgatttacaa taaagacatc attaaagaag cgccaaaaac ctgggaagaa       480
     atcccggcgc tggacaaaga gctgcgcgcc acaggcaaga gcgccatcat gtggaacctg       540
     caggaaccgt acttcacctg gccaatcatc gccgctgacg gcggttatgc gttcaagtat       600
     gaaaacggca aatacaacat caaagacacc ggcgtgaata acgcaggttc acaggctggc       660
     ctgcaattca tcatcgatct ggtgaaaaac aaacacatca acgccgacac cgattactcc       720
     atcgctgaag ccgcctttaa caaaggccag accgcaatga ctatcgacgg tccgtgggcg       780
     tggtcaaacc tcgacaagag caaaatcaac tacggcgtga cgttgctgcc aacgttccac       840
     ggcaagccgt ctaaaccgtt cgtcggcgtg ctgacagccg gtatcaacgc cgccagcccg       900
     aacaaagagc tggcgaaaga gttcctggaa aactacctga tcaccgacga cggtctggcc       960
     gtcgtgaata aggacaaacc gctgggtgcc gtggcgctga agtcttatca ggagaaactg      1020
     gaaaaagacc cgcgcattgc tgccaccatg gcgaactcga agaacggtga aatcatgcca      1080
     aacatcccgc agatgagcgc cttctggtac gcagaacgca gcgccatcat caacgcggtg      1140
     aatggccgtc agaccgttcc gcaagcactg aaagatgtag aaacccgcat taccaagtaa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page