(data stored in SCRATCH zone)

EMBL: CP002505.PE545

CP002505.PE545       Location/Qualifiers
FT   CDS_pept        complement(597564..598361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0550"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: spe:Spro_3426 ABC transporter-related protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADW72178"
FT                   /db_xref="GOA:A0A0H3F5L2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F5L2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADW72178.1"
FT                   /translation="MNTEHSSPLYAKDLTLGYDKKIVARELSVSIPQGKLTVIIGPNAC
FT                   GKSTLLRTLSRLMPPQSGTVFLDGKLIGDYGTRDVAKRLGLLPQSSTAPGDISVADLVA
FT                   RGRYPHQSLFSRWTAQDTLAVNDAMHATGVFELAESTVNSLSGGQRQRVWIAMVLAQQT
FT                   PLLLLDEPTTWLDIAHQIDLMELMCRLNQENGRTLVVVLHDLNQACRYAGHLIAMRDGK
FT                   ILAEGAPADIVTPALIEQVFGLRCAIIDCPVSHTPLIIPLGNG"
     atgaatactg aacactcttc ccctttgtac gcgaaagatc tcacgctggg ctacgataaa        60
     aaaatcgtcg cccgcgaact ctccgtctct atccctcagg gaaaactcac cgtgattatc       120
     gggccgaatg cctgcggtaa atccacacta ttgcgcacgc tcagccgcct gatgccgccg       180
     caatccggca cggtatttct ggacggcaaa ctgatcggtg attacggcac cagagacgtc       240
     gcgaaacgtc tgggtttact gccgcaaagt tcaacggcgc cgggcgatat cagtgtggcg       300
     gatctggtgg cccgcgggcg ttacccgcat cagagcctgt tcagccgctg gacagcgcaa       360
     gatacgctgg cggtgaacga cgccatgcac gcgacgggag tattcgaact ggcggaaagc       420
     acggtgaatt cactttccgg cggacagcgc cagcgggtgt ggatagccat ggtgctggcg       480
     caacaaacgc cgttgttatt gctggatgaa ccgacaacct ggctggatat cgcgcatcag       540
     attgatttga tggaactgat gtgtcgcctg aatcaggaaa acggccgcac gctggtggtg       600
     gtgttgcacg acctgaatca ggcatgtcgt tacgccgggc atctgattgc catgcgcgat       660
     ggaaaaatac tggctgaggg cgcaccggca gacatcgtca caccggcact gatcgaacag       720
     gttttcgggc tacgctgcgc cattatcgac tgtccggttt cgcatacacc gttaattatc       780
     ccgctgggta acggttga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page