(data stored in SCRATCH zone)

EMBL: CP002505.PE59

CP002505.PE59        Location/Qualifiers
FT   CDS_pept        64064..64516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sgl:SG1755 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71692"
FT                   /db_xref="GOA:A0A0H3F4M1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADW71692.1"
FT                   /translation="MSQPQDVMIRLLTPADREGWEALWRDYLDFYQSELDPAQFDYTFQ
FT                   RLSQPDYASMFGYVAEYEGKLVGLVNCINHDHGWHMQQVVYLQDLYVDDRARKLGIGQK
FT                   LIEAVYAYADENNKANVYWTTQTSNHTARKLYDRIGTLTEFIKYSR"
     atgagccagc cgcaagatgt gatgatccgt ctgttaaccc ccgcagaccg tgaaggttgg        60
     gaagcgttat ggcgagatta tctggatttt taccagtcgg agctcgatcc ggcgcaattt       120
     gattacactt tccagcgttt atcacagcct gattacgcca gcatgtttgg ctatgtggcg       180
     gagtacgagg gaaaactggt cgggctggtg aactgtatca atcacgatca tggctggcac       240
     atgcagcagg tggtgtattt gcaggatttg tacgttgacg accgcgcccg caaactgggg       300
     atcgggcaaa aactgattga agcggtttat gcttacgccg acgaaaacaa taaagccaac       360
     gtctactgga ctacccagac ctcaaatcat actgcccgca aactgtatga tcgtattggt       420
     acgctgaccg aatttattaa atattcccgt taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page