(data stored in SCRATCH zone)

EMBL: CP002505.PE64

CP002505.PE64        Location/Qualifiers
FT   CDS_pept        complement(66796..67431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rahaq_0064"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pct:PC1_4180 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Rahaq_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADW71697"
FT                   /db_xref="GOA:A0A0H3F4M4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3F4M4"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADW71697.1"
FT                   /translation="MTVTESLLSYALAAGILTLTPGLDTALVLRTAASQGSKKALSTAF
FT                   GISTGCLVWGAMVALGLGAVLAASEIAFNVLKWIGAAYLAWLGLQMLFKPRNEMNMDAP
FT                   QSRRTALRIGNSPFVKGLFGNVLNPKVGVFYVSFLPQFVATGYPVGPYIFGLAAMHAVI
FT                   GTLWSVTMISATRPLSRWLRRPAVVRTLDRLTGTVFIAFAVRLATTKR"
     atgaccgtta ccgaatccct gctttcttac gcgcttgccg ctggcatttt aaccctcacc        60
     cccggtctcg ataccgcact ggtgctgcgc actgccgcca gtcagggcag taaaaaggcg       120
     ctgtccaccg cttttggcat cagcaccggt tgtctggtct ggggcgcgat ggtagcactt       180
     ggccttggcg ccgtgctcgc tgcctctgaa atcgccttca atgtcttgaa atggatcggt       240
     gccgcgtatc tggcctggct cggcctgcag atgttgttca aaccccgcaa cgaaatgaac       300
     atggatgcgc cgcaaagccg ccgcaccgcc ttacgcatcg ggaactcgcc gttcgttaaa       360
     ggcctttttg gcaacgtgct taacccgaaa gtcggtgtgt tttatgtctc tttcctgccg       420
     cagttcgtcg ccaccggcta tccggtcggg ccgtacattt tcggcctcgc ggccatgcat       480
     gcggtgatcg ggacgttatg gtcggtcacc atgatttcgg ccacccgccc gctgtcgcgc       540
     tggttgcgcc gtccggcagt ggtcagaacg ctggaccggc tcaccggcac cgtgtttatc       600
     gcttttgcag ttcgcctcgc tacgacaaaa cgttaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page