(data stored in ACNUC13479 zone)

EMBL: CP002688.ACI1

CP002688.ACI1        Location/Qualifiers
FT   CDS_pept        join(152575..153523,153961..154295)
FT                   /codon_start=1
FT                   /gene="ACI1"
FT                   /gene_synonym="ALC-interacting protein 1"
FT                   /gene_synonym="T10O8.80"
FT                   /gene_synonym="T10O8_80"
FT                   /gene_synonym="TON1 Recruiting Motif 29"
FT                   /gene_synonym="TRM29"
FT                   /locus_tag="AT5G01370"
FT                   /product="ALC-interacting protein 1"
FT                   /note="ALC-interacting protein 1 (ACI1); Has 1807 Blast
FT                   hits to 1807 proteins in 277 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M035"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M035"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EG501526.1,INSD:DR297132.1,INSD:ES031379.1,
FT                   INSD:EG501536.1,INSD:EL159890.1,INSD:EG501527.1,
FT                   INSD:EG456881.1,INSD:DR355559.1,INSD:ES100852.1,
FT                   INSD:EH848113.1,INSD:EG456880.1,INSD:ES086872.1,
FT                   INSD:DR382153.1,INSD:EL016085.1,INSD:ES145943.1,
FT                   INSD:EG501537.1,INSD:ES139644.1,INSD:DR380950.1,
FT                   INSD:EL126278.1,INSD:ES012991.1,INSD:EL991033.1,
FT                   INSD:EH870662.1,INSD:DR381859.1,INSD:EH823594.1,
FT                   INSD:DR355560.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX829513.1,INSD:BT030028.1"
FT                   /protein_id="AED90333.1"
FT                   /translation="MTQRANPKTGCLTAVVRRLLCSGSQQTHPSDNILDSDETLQLLIS
FT                   YEENEEPKKEIKTETETQNDDVSLHPPPPPPPPNVVAKLMGLDHPAPGSKRFRYFDDSG
FT                   SAVTRSKSVNFMDYILKGHEEEEENEDEKDGQRQCRRVKASVSFREIVPTSARWSSNNQ
FT                   QKKHDFLLLYLDKLDEKRELVGSSSFSRSKRFEKVVEDSKKPPLPPSAPKKKENEKVAK
FT                   KFKDEPRKVAKKKKSENRNDVNGAKKVRWFLSPSKSKSSSEKTALLGESKNIRADEFIG
FT                   KESESPENKSNASPVSVLDRDLYDYLILDDDYYFSGGDSESASELSTKQVETATKSSCS
FT                   SSPAKTKTSTKKENNNSTNNDSEETEFITKLMNMLSDLSEEDMKSSTWVSTSSTKPVDF
FT                   TQVEDFCVEFGQEILDLVMDQLVDELCI"
     atgacccaac gagccaaccc taagaccggc tgcctcacgg cggtagtccg ccgtcttcta        60
     tgctctggta gccaacagac tcacccttcc gacaacatcc tcgactctga cgaaacactc       120
     caactactaa tctcttacga agaaaacgaa gagccaaaga aagagatcaa aaccgaaacc       180
     gaaacccaaa acgatgacgt ctctcttcac cctccaccac ctcctcctcc tcccaacgtt       240
     gtagccaaac tcatggggct agatcatccc gcacccggat caaaacggtt ccggtacttt       300
     gatgattccg gttcggctgt cacaaggagc aaatcggtta acttcatgga ctacatccta       360
     aaaggtcacg aggaagaaga agaaaacgaa gacgagaaag acggtcaacg tcagtgccgg       420
     agagtcaaag cttccgtttc tttccgtgag atagtcccaa cctcggcgag atggagctct       480
     aataaccaac aaaagaaaca tgatttcctg ctgttgtatc ttgacaagct tgacgagaag       540
     agagaacttg tcggatcatc gtctttttcg aggtctaaaa ggttcgagaa ggttgtggaa       600
     gattccaaga agccgccatt gccaccttcg gcgccgaaga agaaggagaa cgagaaagtt       660
     gctaagaagt ttaaagatga gccgaggaaa gttgcgaaga agaagaagag tgagaatcga       720
     aatgacgtta acggagccaa gaaagttcgt tggtttcttt ctccatctaa gagtaagtcg       780
     tcgtcggaga agactgcgct tctaggagaa tcaaagaata ttcgggctga tgagtttatc       840
     ggaaaagaga gtgagtcgcc ggagaataag tctaacgcga gtccggtttc ggttcttgat       900
     cgagatcttt atgattatct aatccttgac gatgattact acttctcagg aggagattca       960
     gaaagtgcat cggagttgtc aacaaagcaa gtagagacag caacaaaatc ttcatgttct      1020
     tcatcaccag caaaaacaaa aacaagtacc aagaaagaaa acaacaatag caccaacaat      1080
     gattcagaag agacagagtt tatcacaaaa ctaatgaata tgctctcaga tctgtctgaa      1140
     gaagacatga agtcttccac ttgggtttct acttcgtcaa ctaaacccgt tgactttact      1200
     caggtcgaag atttttgtgt cgaatttggt caagagattc ttgaccttgt tatggaccag      1260
     ctagttgatg aactctgtat ctag                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page