(data stored in ACNUC13479 zone)

EMBL: CP002688.AIRP2

CP002688.AIRP2       Location/Qualifiers
FT   CDS_pept        join(206797..206861,207453..207603,207703..207769,
FT                   207867..208101,208189..208399)
FT                   /codon_start=1
FT                   /gene="AIRP2"
FT                   /gene_synonym="F7A7.40"
FT                   /gene_synonym="F7A7_40"
FT                   /gene_synonym="ABA Insensitive RING Protein 2"
FT                   /gene_synonym="AtAIRP2"
FT                   /locus_tag="AT5G01520"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; EXPRESSED IN: 17 plant structures; EXPRESSED
FT                   DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, RING-type, conserved site (InterPro:IPR017907),
FT                   Zinc finger, RING-type (InterPro:IPR001841), Zinc finger,
FT                   C3HC4 RING-type (InterPro:IPR018957); BEST Arabidopsis
FT                   thaliana protein match is: RING/U-box superfamily protein
FT                   (TAIR:AT3G47160.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M022"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M022"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES200245.1,INSD:CB257492.1,INSD:AV557717.1,
FT                   INSD:ES024579.1,INSD:T22636.1,INSD:BP671900.1,
FT                   INSD:BP843186.1,INSD:AV826358.1,INSD:BU635339.1,
FT                   INSD:ES071674.1,INSD:AV794566.1,INSD:AA712150.1,
FT                   INSD:ES152097.1,INSD:AV564168.1,INSD:ES113693.1,
FT                   INSD:BP856644.1,INSD:BP663168.1,INSD:AV827590.1,
FT                   INSD:CK118139.1,INSD:ES004530.1,INSD:ES019253.1,
FT                   INSD:BP661628.1,INSD:EH934658.1,INSD:BP660462.1,
FT                   INSD:EL295849.1,INSD:N96366.1,INSD:T43550.1,
FT                   INSD:BP804842.1,INSD:ES089210.1,INSD:ES086864.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:DQ059129.1,INSD:AY050835.1,INSD:AY091165.1"
FT                   /protein_id="AED90356.1"
FT                   /translation="MRKSFKDSLKALEADIQFANTLASEYPEEYDGGYVQMRLSYSPAA
FT                   HLFLFLLQWTDCHFAGALGLLRILIYKAYVDGKTTMSLHERKTSIREFYDVLFPSLLQL
FT                   HGGITDVEERKQKEICDKRYRKKDRTDKGKMSEIDLEREEECGICLEIRNKVVLPTCNH
FT                   SMCINCYRNWRARSQSCPFCRGSLKRVNSGDLWIYTCSAEIADLPAIYKENLKRLLIYI
FT                   DKLPLVTSDPNLVPYAPLPR"
     atgcgaaaat cgttcaagga ttcactcaag gctcttgaag ctgatatcca gttcgccaac        60
     actctggcgt cagagtaccc agaggagtat gatggtggct acgttcagat gagattatct       120
     tacagcccgg cggctcatct ctttctcttc cttcttcagt ggactgattg tcatttcgct       180
     ggcgctttgg gcttgcttag gatccttatt tataaggcat atgttgatgg gaagaccaca       240
     atgtcgctac atgaacgcaa aactagtatc agagaattct atgatgtgtt gtttccttcg       300
     ctattgcaac ttcatggagg gatcaccgat gtagaagaaa ggaaacagaa ggagatatgc       360
     gacaaaagat accgtaaaaa ggacagaaca gataaaggaa agatgtcgga gatcgatttg       420
     gagagggaag aagagtgtgg aatctgcttg gagattcgaa acaaagttgt tcttcctacg       480
     tgcaatcact ccatgtgtat aaactgctac agaaactggc gtgcacggtc acagtcgtgc       540
     ccgttctgtc gaggcagctt gaaaagagtg aattctggtg atctatggat atacacttgt       600
     agcgccgaga ttgcagattt accagcgatt tacaaggaga atctgaagag gttgttgata       660
     tacattgaca agttgcctct cgttacttct gatccaaatc ttgtccctta tgctcctctt       720
     cctcggtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page