(data stored in ACNUC13479 zone)

EMBL: CP002688.APD2

CP002688.APD2        Location/Qualifiers
FT   CDS_pept        complement(join(183693..183768,183891..184194,
FT                   184298..184370,184515..184661,184819..184901,
FT                   184989..185063,185419..185512,185591..185716,
FT                   185803..185909,185995..186244))
FT                   /codon_start=1
FT                   /gene="APD2"
FT                   /gene_synonym="T10O8.160"
FT                   /gene_synonym="T10O8_160"
FT                   /gene_synonym="ABERRANT POLLEN DEVELOPMENT 2"
FT                   /locus_tag="AT5G01450"
FT                   /product="RING/U-box superfamily protein"
FT                   /note="RING/U-box superfamily protein; FUNCTIONS IN: zinc
FT                   ion binding; INVOLVED IN: biological_process unknown;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN: 24
FT                   plant structures; EXPRESSED DURING: 11 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Zinc finger, RING-type
FT                   (InterPro:IPR001841); BEST Arabidopsis thaliana protein
FT                   match is: RING/U-box superfamily protein
FT                   (TAIR:AT2G38185.2); Has 1494 Blast hits to 1490 proteins in
FT                   181 species: Archae - 0; Bacteria - 0; Metazoa - 838; Fungi
FT                   - 48; Plants - 298; Viruses - 88; Other Eukaryotes - 222
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q6DBH0"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR032008"
FT                   /db_xref="InterPro:IPR032010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DBH0"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BE529281.1,INSD:ES116463.1,INSD:CF773968.1,
FT                   INSD:AV518482.1,INSD:EG512545.1,INSD:AA651416.1,
FT                   INSD:EL237213.1,INSD:AV439912.1,INSD:ES149332.1,
FT                   INSD:AU237497.1,INSD:EH867362.1,INSD:ES122109.1,
FT                   INSD:EL068859.1,INSD:AV525674.1,INSD:CF773035.1,
FT                   INSD:ES137837.1,INSD:AU228571.1,INSD:BU635166.1,
FT                   INSD:DR353056.1,INSD:AV534498.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT015052.1,INSD:BT015858.1,INSD:AK229004.1,
FT                   INSD:BX831291.1"
FT                   /protein_id="AED90346.1"
FT                   /translation="MSLPDSLPSSSSSPPVTREETGFHRFEHHGNDSGFDHRDRPPWNR
FT                   SEYDYRHGSVVASENVRNNSTSEDPWSCVVVVATFCIFVSMTLILGLYGTTNVWLGPNS
FT                   SFLIKPTSVFVQNVIVEELGNKGSGLILYGLNQAPQLDVLTKWSEVHYLAVPNDSYKYW
FT                   IQYLNKGSRVKVSYNVESVGSSLYLVIAQGVDGLSEWVQDPTRPDTTLSWHIISDSGYI
FT                   EQDITKSSSYYVAVGNVYLNEVKATIDIQVEGVLYDTTNAYYNCSFPNDKCTLSVPLFG
FT                   TNAAVLTSPGPKLNNSKNEFCAKLSYEPRWIAYIVCMGVVTALLLIVSSLFNKRQPVTE
FT                   DETVDENDDVAPLIPGKDDDNSSWCSSYSSILTSTEELEGAHGEGHSSTRYLCAICYDA
FT                   PRDCFFLSCGHCVACFQCGTRIAETSGFCPVCRKKIRKVKKIFNV"
     atgtctctac cggattctct cccatcttct tcttcttctc cgcctgtgac ccgtgaagaa        60
     accggctttc atcgctttga acatcacggc aacgattccg gttttgatca tcgtgatcgt       120
     ccaccgtgga atcgttctga gtacgattat cgccatggaa gcgttgttgc atctgagaac       180
     gtcaggaaca attccacttc tgaagaccct tggtcttgcg ttgtcgtcgt tgctaccttc       240
     tgtatctttg tgtcgatgac tttgattctg gggctttatg gaacaacgaa tgtctggttg       300
     ggaccaaact cttcgtttct tattaagcca acttcagtgt tcgtccaaaa tgtcattgtg       360
     gaagaattag ggaacaaggg atctggtttg atactgtatg gattgaacca agccccacag       420
     cttgatgttc tgactaaatg gtccgaagtt cactatctag ctgtgcctaa tgattcttac       480
     aagtattgga tacagtattt gaacaagggg tcacgcgtaa aagtttcata caacgttgaa       540
     tctgtgggtt cttccttata ccttgtgata gcccaaggtg tggatgggct ctctgagtgg       600
     gtacaagatc cgacgcgtcc agacactaca ctgtcgtggc atataatctc tgatagtggt       660
     tatattgagc aggacataac taagtcgtcg agttattatg ttgcagtagg caacgtatac       720
     ctgaatgaag tgaaggcgac gattgacatt caagttgagg gggtattgta tgatactaca       780
     aatgcttatt acaattgctc tttccctaac gacaagtgca ctctaagtgt tccattattt       840
     ggaactaatg ctgctgtact aacctcacca ggtccaaagc tgaacaattc taagaatgag       900
     ttctgcgcaa aactctcata tgaaccaagg tggattgcat acatagtttg catgggtgta       960
     gtgacagcac tcttgttaat tgtctcgagt ctcttcaata aacgacaacc agtcactgaa      1020
     gatgaaaccg ttgatgaaaa tgatgatgta gctcctctaa ttccgggaaa agacgatgat      1080
     aactcaagct ggtgctcgtc ctacagttct attttgacga gtacagagga attggaaggt      1140
     gcacatggtg aaggccacag tagtacaaga tatctatgtg caatttgcta tgatgcgcct      1200
     agagactgtt tcttcctctc ttgtggacac tgcgttgctt gcttccagtg cgggacacgg      1260
     atagctgaaa cttcgggttt ttgtccggta tgccgtaaga agatcaggaa ggtcaagaag      1320
     atcttcaatg tctaa                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page