(data stored in ACNUC13479 zone)

EMBL: CP002688.APTX

CP002688.APTX        Location/Qualifiers
FT   CDS_pept        join(126329..126502,126668..127539,127617..128214,
FT                   128300..128470,128643..128960)
FT                   /codon_start=1
FT                   /gene="APTX"
FT                   /gene_synonym="APRATAXIN-like"
FT                   /gene_synonym="T10O8.20"
FT                   /gene_synonym="T10O8_20"
FT                   /locus_tag="AT5G01310"
FT                   /product="APRATAXIN-like protein"
FT                   /note="APRATAXIN-like (APTX); FUNCTIONS IN:
FT                   adenylylsulfatase activity, sequence-specific DNA binding
FT                   transcription factor activity; INVOLVED IN: sulfur
FT                   metabolic process, purine ribonucleotide metabolic process,
FT                   regulation of transcription; LOCATED IN: intracellular,
FT                   nucleus, chloroplast; EXPRESSED IN: 11 plant structures;
FT                   EXPRESSED DURING: 4 anthesis, C globular stage, petal
FT                   differentiation and expansion stage, E expanded cotyledon
FT                   stage, D bilateral stage; CONTAINS InterPro DOMAIN/s: Zinc
FT                   finger, C2H2-like (InterPro:IPR015880), Appr-1-p processing
FT                   (InterPro:IPR002589), Histidine triad (HIT) protein
FT                   (InterPro:IPR001310), Helix-loop-helix DNA-binding domain
FT                   (InterPro:IPR001092), Histidine triad motif
FT                   (InterPro:IPR011151), Helix-loop-helix DNA-binding
FT                   (InterPro:IPR011598), Histidine triad-like motif
FT                   (InterPro:IPR011146), Histidine triad, conserved site
FT                   (InterPro:IPR019808); BEST Arabidopsis thaliana protein
FT                   match is: basic helix-loop-helix (bHLH) DNA-binding
FT                   superfamily protein (TAIR:AT3G21330.1); Has 1807 Blast hits
FT                   to 1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:A0A2H1ZE58"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032566"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H1ZE58"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL019604.1,INSD:EH947045.1,INSD:ES105740.1,
FT                   INSD:ES082029.1,INSD:EH948278.1,INSD:BP788122.1,
FT                   INSD:EL248113.1,INSD:EL300374.1,INSD:EL251986.1"
FT                   /protein_id="AED90326.2"
FT                   /translation="MEVQIEESGKNQTSPESIEADKAKQIVVLLIGPPGSGKSTFCDTA
FT                   MRSSHRPWSRICQDIVNNGKAGTKAQCLKMATDSLREGKSVFIDRCNLDREQRSEFIKL
FT                   GGPEFEVHAVVLELPAQVCISRSVKRTGHEGNLQGGRAAAVVNKMLQSKELPKVNEGFS
FT                   RIMFCYSDADVDNAVNMYNKLGPMDTLPSGCFGEKKLDTKSQPGIMKFFKKVSALPASS
FT                   SNEATNTTRKADEMTANVRVSPVKLGSADIVPTLAFPSISTADFQFDLEKASDIIVEKA
FT                   EEFLSKLGTARLVLVDLSRGSKILSLVKAKASQKNIDSAKFFTFVGDITKLRSEGGLHC
FT                   NVIANATNWRLKPGGGGVNAAIFKAAGPDLETATRVRANTLLPGKAVVVPLPSTCPLHN
FT                   AEGITHVIHVLGPNMNPNRPDNLNNDYTKGCKTLREAYTSLFEGFLSVVQDQSKLPKRS
FT                   SQTAVSDSGEDIKEDSERNKKYKGSQDKAVTNNLESESLEDTRGSGKKMSKGWNTWALA
FT                   LHSIAMHPERHENVVLEYLDNIVVINDQYPKARKHVLVLARQESLDGLEDVRKENLQLL
FT                   QEMHNVGLKWVDRFQNEDASLIFRLGYHSVPSMRQLHLHVISQDFNSDSLKNKKHWNSF
FT                   TTSFFRDSVDVLEEVNSQGKANVASEDLLKGELRCNRCRSAHPNIPKLKSHVRSCHSQF
FT                   PDHLLQNNRLVARAET"
     atggaagtgc aaattgaaga atctggtaaa aatcaaacct ctccggaatc aattgaagca        60
     gacaaagcga agcagatagt ggtgcttctg attggtccac caggaagcgg caaatcgacg       120
     ttttgtgaca ccgcaatgcg ttcctctcac cgcccttggt ctcgtatctg ccaggacatt       180
     gttaacaatg gcaaagctgg aacaaaggct cagtgtttaa agatggctac agattctctt       240
     agggaaggca agagcgtctt tatagacaga tgcaatcttg acagggagca acgttcagag       300
     tttattaagc ttggtggtcc tgagttcgaa gttcatgcag tggttctgga gcttcctgct       360
     caggtttgta tatctagatc agttaaaaga actggtcatg aaggaaatct acaaggtgga       420
     agagctgcag ctgttgtgaa taagatgctt cagagtaagg aacttcccaa agtgaatgaa       480
     gggttttctc ggattatgtt ttgttacagt gacgctgatg ttgataatgc tgttaacatg       540
     tataacaagc ttggtccaat ggataccctt ccttctggct gttttggcga aaaaaaatta       600
     gatactaaaa gccaacccgg tataatgaag ttctttaaga aagtcagtgc tctgcctgct       660
     tcatcttcta atgaagctac taacacaact cggaaagctg atgaaatgac agcaaatgtc       720
     cgagtttcgc cagtcaagct tggttctgct gatattgtac ctacactggc attcccatca       780
     atttcgactg cggattttca gtttgatctt gaaaaggctt ctgatatcat tgtggagaaa       840
     gcagaggagt tcttgtctaa acttgggact gcgcgtctcg tcttggtgga cttgagccgc       900
     gggtcaaaga ttctatctct ggtcaaggct aaggcttctc agaagaacat tgattcagcg       960
     aaattcttca catttgttgg ggacataact aagcttcgtt ctgaaggtgg tctacactgt      1020
     aatgtcatag ctaatgctac taactggcgg cttaaacctg gaggtggagg tgtgaatgca      1080
     gcaatattca aagctgctgg tccagatctt gagactgcga caagagtacg agcaaacact      1140
     cttcttcctg gaaaagccgt ggtagttcct cttccttcta cttgtccatt acacaatgca      1200
     gaaggaatta cacatgtcat acatgttcta ggaccaaaca tgaacccaaa ccgaccagac      1260
     aaccttaaca acgactacac caaggggtgc aaaactctcc gggaagctta cacatctcta      1320
     tttgaaggtt ttctatcagt agtacaggat caatcgaagt tgcccaaacg aagcagtcaa      1380
     acagctgtgt cagattctgg tgaggatatt aaggaagact ctgagagaaa caaaaagtac      1440
     aaaggatcac aagataaggc cgtaactaat aatttggaat cagagtctct ggaggacaca      1500
     agaggcagtg gaaagaagat gagtaaagga tggaacacat gggcattggc tctccacagc      1560
     atcgcgatgc acccagagag acacgagaat gtcgtgcttg aatatttaga caacatcgtt      1620
     gtcataaacg accagtaccc aaaggcgcgg aaacacgtgc tagtactggc gagacaggag      1680
     agtctagatg ggctagaaga tgttcgcaaa gagaatcttc aacttctgca ggaaatgcac      1740
     aatgttggtc tgaaatgggt tgatagattc cagaacgagg atgcatctct tatcttccgc      1800
     cttggatatc actcggttcc ctcgatgcga caactacact tacacgttat aagccaagac      1860
     tttaattcag atagtttgaa gaacaagaaa cactggaact ctttcacgac ctcgttcttc      1920
     cgtgactcag ttgatgtact tgaagaggtc aacagccaag gcaaggccaa tgtggcgagc      1980
     gaagatctgt tgaaaggtga gctgcgttgc aatcggtgta gaagcgcaca cccaaatatt      2040
     ccaaaactta aatcacatgt cagaagctgc cattctcaat ttccagacca tttactccaa      2100
     aacaatcgcc ttgtggctag agcagagacg tag                                   2133
//

If you have problems or comments...

PBIL Back to PBIL home page