(data stored in ACNUC13479 zone)

EMBL: CP002688.BRCA2B

CP002688.BRCA2B      Location/Qualifiers
FT   CDS_pept        complement(join(235117..235182,235275..235448,
FT                   235552..235756,235846..235908,235982..236124,
FT                   236411..236593,236662..236860,237159..237230,
FT                   237314..237425,237525..237606,237693..237743,
FT                   237843..237924,237999..238184,238257..238379,
FT                   238541..238695,238783..238907,239000..239986,
FT                   240231..240392,240528..240671,240758..240911))
FT                   /codon_start=1
FT                   /gene="BRCA2B"
FT                   /gene_synonym="ATBRCA2(V)"
FT                   /gene_synonym="BRCA2(V)"
FT                   /gene_synonym="BRCA2-like B"
FT                   /gene_synonym="F7A7.150"
FT                   /gene_synonym="F7A7_150"
FT                   /locus_tag="AT5G01630"
FT                   /product="BRCA2-like B"
FT                   /note="BRCA2-like B (BRCA2B); FUNCTIONS IN: single-stranded
FT                   DNA binding; INVOLVED IN: meiosis; LOCATED IN:
FT                   mitochondrion; CONTAINS InterPro DOMAIN/s: Nucleic
FT                   acid-binding, OB-fold-like (InterPro:IPR016027), DNA
FT                   recombination/repair protein BRCA2, helical domain
FT                   (InterPro:IPR015252), DNA recombination and repair protein,
FT                   BRCA2 (InterPro:IPR011370), BRCA2,
FT                   oligonucleotide/oligosaccharide-binding 1
FT                   (InterPro:IPR015187), Breast cancer type 2 susceptibility
FT                   protein (InterPro:IPR015525), BRCA2 repeat
FT                   (InterPro:IPR002093); BEST Arabidopsis thaliana protein
FT                   match is: BREAST CANCER 2 like 2A (TAIR:AT4G00020.1); Has
FT                   281 Blast hits to 210 proteins in 91 species: Archae - 0;
FT                   Bacteria - 4; Metazoa - 134; Fungi - 18; Plants - 61;
FT                   Viruses - 0; Other Eukaryotes - 64 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q7Y1C4"
FT                   /db_xref="InterPro:IPR002093"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015187"
FT                   /db_xref="InterPro:IPR015252"
FT                   /db_xref="InterPro:IPR015525"
FT                   /db_xref="InterPro:IPR036315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y1C4"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EL083723.1,INSD:EH957220.1,INSD:AU227536.1,
FT                   INSD:DR379270.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AJ488305.1,INSD:BT004117.1"
FT                   /protein_id="AED90369.1"
FT                   /translation="MSTWHLFSDSSGDGFRWEVAGRILQSVSDSTPTKALESTAPLPSM
FT                   ADLLLQGCSKLIEREESMPGEIPMFRTGLGKSVVLKESSIAKAKSILAENVAYSDLQNT
FT                   NCSIPQTRQVDTAETMPMFRTALGKTVPLKESSIAKPLSILGSDMIIDSDNVLPRESGF
FT                   GVPNSLFQTASNKKVNVSSAGLARAKALLGLEEDDLNGFNHVNQSSSSLQQHGWSGLKT
FT                   HEEFDATVVKHHSGTPGQYENYVSGKRSEILNPSLKVPPTKFQTAGGKSLSVSAEALKR
FT                   ARNLLGDPELGSFFDDVAGGDQFFTPQKDERLSDIAINNGSVNTGYIAHEEKTSNKHTS
FT                   NSFVSPLHSSSKQFRSVNLENLASGGNLIKKFDTAVDETNCALNISKPATHGLSNNRPL
FT                   ASDMAVNNSKGNGFIPRARQLGRPADQPLVDITNRRDTAYANNKQDSTQKKRLGKTVSV
FT                   SPFKRPRISSFKTPLKKNAQQASSGLSVVSCDTLTSKKVLSTRYPEKSPRVYIKEFFGM
FT                   HPTATTRMDYVPDHVRRIKSSNADKYVFCDESSSNKVGAETFLQMLAESGASLQHASRK
FT                   WVTNHYRWIVWKLACYDIYYPAKCRGNFLTITNVLEELKYRYEREVNHGHCSAIKRILS
FT                   GDAPASSMMVLCISAINPRTDNGSQEAHCSDNCSNVKVELTDGWYSMNAALDVVLTKQL
FT                   NAGKLFVGQKLRILGAGLSGWATPTSPLEAVISSTICLLLNINGTYRAHWADRLGFCKE
FT                   IGVPLAFNCIKCNGGPVPKTLAGITRIYPILYKERLGEKKSIVRSERIESRIIQLHNQR
FT                   RSALVEGIMCEYQRGINGVHSQNDTDSEEGAKVFKLLETAAEPELLMAEMSLEQLTSFT
FT                   TYKAKFEAAKQMQMEKSVAKALEDAGLGERNVTPFMRIRLVGLTSLSNEGEHNPKEGIV
FT                   TIWDPTERQRTELTEGKIYIMKGLVPMNSDSETLYLHARGSSSRWQPLSPKDSENFQPF
FT                   FNPRKPISLSNLGEIPLSSEFDIAAYVVYVGDAYTDVLQKKQWVFVTDGSTQHSGEISN
FT                   SLLAISFSTPFMDDSSVSHISHNLVGSVVGFCNLIKRAKDATNEMWVAETTENSVYFIN
FT                   AEAAYSSHLKTRSAHIQTWAKLYSSKSVIHELRQRVLFIIGACKSPSC"
     atgtcgacgt ggcatttatt ttccgattcc agcggcgatg gtttccggtg ggaagtcgct        60
     ggccggattc ttcagtccgt ctcggattct acgccaacca aggcgctcga atcgacagct       120
     cctctacctt ccatggccga tctcttgctc caaggatgct cgaagcttat agaacgggaa       180
     gaatcgatgc ctggggaaat cccaatgttc aggactgggc tggggaagtc tgtagttctt       240
     aaagagtctt cgattgctaa agccaaatcc attttagcag agaatgttgc ttattcagat       300
     ttgcagaaca caaattgctc aattccccaa acgagacaag tggatacagc tgaaactatg       360
     ccaatgttca ggacggcctt ggggaaaact gtccctttga aagagtcttc aattgccaaa       420
     cctttgtcta ttctaggaag tgatatgata attgactcag acaacgttct tcccagggag       480
     agtgggtttg gtgttcccaa cagtcttttt cagacagctt ccaacaaaaa ggttaatgta       540
     tcttctgccg gtttagcaag agccaaggca ttgttaggac tagaagaaga tgatttgaat       600
     ggatttaacc atgtgaacca gtcgtcttct tccctccagc aacatgggtg gtccggttta       660
     aaaactcatg aggagtttga tgctacagtg gttaagcatc attcaggaac tccaggacaa       720
     tatgagaatt atgtatctgg gaagagatct gaaatcttaa atccatcgtt aaaggtgcct       780
     ccaacaaagt ttcagactgc tggtggaaaa tcattgtcag tgtcagctga ggcgttgaaa       840
     cgtgccagaa accttcttgg tgaccctgag ttagggtctt tctttgatga tgtagctgga       900
     ggtgatcaat tttttacacc acagaaagat gaaaggctaa gtgatattgc tataaacaat       960
     ggaagtgtca acacaggtta tattgctcat gaagaaaaga caagcaacaa acatacgtca      1020
     aatagttttg tatctcctct tcattcatct tcaaagcaat ttagatcagt taacttggag      1080
     aacctagctt cagggggtaa tttgatcaag aaatttgata cggctgttga tgagaccaat      1140
     tgtgctctga atatcagtaa acctgctaca catggactat caaataacag gcctttagca      1200
     tcagatatgg cagtgaataa ttccaaggga aacggtttca ttccaagagc taggcaactt      1260
     ggaaggcctg ctgatcagcc acttgttgat ataacaaatc gcagagatac agcttatgca      1320
     aacaataaac aagacagtac ccaaaagaaa aggctgggaa agacagtctc cgtttctcct      1380
     ttcaaaaggc caaggatttc atcctttaaa actcctttaa agaaaaatgc tcagcaagct      1440
     tcaagtggtt tgtctgttgt atcgtgtgat acacttactt ccaaaaaggt actttctaca      1500
     agatatccag aaaagtctcc aagagtatat atcaaggagt tttttggaat gcatccgaca      1560
     gctacgacca ggatggatta tgtgccagac catgtcagaa gaatcaaatc aagtaatgca      1620
     gataaatatg tattctgtga tgagtcttct tcaaacaagg ttggagctga aacttttctt      1680
     caaatgttgg ctgagtcggg tgcttcctta caacatgcat ccagaaagtg ggttactaat      1740
     cactacaggt ggatagtctg gaaacttgca tgctacgaca tatactaccc agccaaatgc      1800
     agaggaaact ttctaacaat caccaatgtt cttgaggaac taaaatacag atatgagaga      1860
     gaggtcaatc atggtcattg ctctgcaatc aagaggattc tgagtggtga tgctccagct      1920
     tcttcaatga tggtcctctg catatcagct attaatccaa ggaccgataa tggttctcag      1980
     gaagcacatt gttctgataa ttgcagcaat gtgaaagtcg aactcactga tgggtggtac      2040
     tcgatgaatg ctgctctgga tgtcgtgcta accaagcagc tgaatgctgg caaattgttt      2100
     gtggggcaga agcttcgaat cctcggggca ggactttctg gctgggctac cccaacatca      2160
     ccacttgagg cagtgatttc aagtacaatc tgtttgttgt tgaatattaa tgggacatac      2220
     agagctcact gggcggaccg actaggcttc tgtaaagaaa ttggtgtccc tctggctttc      2280
     aactgtatca agtgcaatgg gggtccagtg cctaaaacgc tagctggcat cacacgaata      2340
     taccccatcc tatacaagga aaggttaggt gaaaagaagt caatagttcg atcagagaga      2400
     atagaaagta gaattataca gctgcataat cagaggcgct cagctcttgt tgagggtatt      2460
     atgtgtgagt accagagagg aattaatggt gttcacagcc aaaacgatac tgacagcgaa      2520
     gaaggagcca aggtctttaa gctgttagag acggctgctg aacctgaact tcttatggct      2580
     gaaatgagcc tagagcagtt gacatctttc actacatata aagcaaaatt tgaggcagcc      2640
     aagcaaatgc agatggaaaa atcagtggca aaagctctgg aagacgctgg tttaggtgaa      2700
     aggaacgtca ccccattcat gaggattagg cttgttggcc tgacgagctt aagtaatgaa      2760
     ggagagcaca atccaaaaga aggcattgta acaatctggg atcccacgga gagacagaga      2820
     accgagctga cggaggggaa aatatacata atgaaagggc tagtaccaat gaactcagat      2880
     tcagaaacac tttacttaca tgccagaggg tcaagctcaa gatggcagcc tttgtctcca      2940
     aaagattctg aaaattttca gccttttttc aaccctcgta aaccaatctc tttgtcaaat      3000
     cttggtgaaa ttcctctgtc aagtgaattt gatatcgctg cgtacgttgt atatgttgga      3060
     gatgcataca cagatgttct acaaaagaag cagtgggtgt ttgtgacaga tggatccaca      3120
     caacattcag gggaaatctc aaacagtctt cttgctataa gcttcagcac cccattcatg      3180
     gatgatagct ctgtttccca catcagccat aatttggttg gatccgtggt cggattttgc      3240
     aatctaatta aaagagcaaa ggatgcgaca aacgaaatgt gggttgctga gacaacagag      3300
     aactcagtct acttcataaa cgcagaagct gcctactctt ctcaccttaa aacccgcagt      3360
     gcccatatcc aaacatgggc taagctctat tcttccaaat ccgtcatcca tgaacttcgg      3420
     caaagagtcc tatttataat cggtgcttgt aaatcacctt catgctga                   3468
//

If you have problems or comments...

PBIL Back to PBIL home page