(data stored in ACNUC13479 zone)

EMBL: CP002688.BSK10

CP002688.BSK10       Location/Qualifiers
FT   CDS_pept        join(22740..23054,23136..23271,23359..23492,23580..23771,
FT                   23858..24079,24181..24336,24412..24525,24617..24847)
FT                   /codon_start=1
FT                   /gene="BSK10"
FT                   /gene_synonym="F7J8.40"
FT                   /gene_synonym="F7J8_40"
FT                   /gene_synonym="brassinosteroid-signaling kinase 10"
FT                   /locus_tag="AT5G01060"
FT                   /product="kinase with tetratricopeptide repeat
FT                   domain-containing protein"
FT                   /note="Protein kinase protein with tetratricopeptide repeat
FT                   domain; FUNCTIONS IN: binding, protein kinase activity,
FT                   kinase activity, ATP binding; INVOLVED IN: protein amino
FT                   acid phosphorylation, N-terminal protein myristoylation;
FT                   LOCATED IN: cellular_component unknown; EXPRESSED IN:
FT                   petal, cotyledon, root; EXPRESSED DURING: petal
FT                   differentiation and expansion stage; CONTAINS InterPro
FT                   DOMAIN/s: Tetratricopeptide-like helical
FT                   (InterPro:IPR011990), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Serine-threonine/tyrosine-protein
FT                   kinase (InterPro:IPR001245), Protein kinase-like domain
FT                   (InterPro:IPR011009); BEST Arabidopsis thaliana protein
FT                   match is: Protein kinase protein with tetratricopeptide
FT                   repeat domain (TAIR:AT3G09240.1); Has 1807 Blast hits to
FT                   1807 proteins in 277 species: Archae - 0; Bacteria - 0;
FT                   Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFD0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFD0"
FT                   /protein_id="AED90293.1"
FT                   /translation="MGCICFKSWRRSSSSPSITSTVIDDLENVREYDADDDGGHYPLIF
FT                   REFSLEQLRIATDGFSAGNIVSEHNDSVPNIVYKGKLGDGRRIAVKRFQRLSWPDPFEF
FT                   INEAQAVGRLRSEHMANLIGCCCDDNERLLVAEYMPNGTLAKHLFHWEKRPMKWEMRLK
FT                   VALHTARALEYCNDKGIDLYHDLNPYRIMFDKTGIPKLSCFGLMKNSHEGKIYSTNLAF
FT                   APPEYLRLGTVIAESVTFSFGTLLLDLMSGRHIPPNHALDLFRGKNYLVLMDSALDGQF
FT                   SDEDRTELIHVASRCFKTEPEERPSIKFLKATLSRLQKRAKLCPINVKRPMSPPSKNLP
FT                   EKTKPATESLKLTPFGDACSRADLSSIHELLEKLGYEEDNGVGNEFSFQMWTGEMQENM
FT                   DYKKHGDAAFLAKDFDTAIEFYTEFMTGAPTVSPTVLARRCLCYLMTEMFSEALSDAMQ
FT                   AQVASPEWPIPLYLQAACLFKLEMEAEAKEALRHGSALEAY"
     atgggatgca tttgcttcaa gtcttggcgc cgatcatctt cttcaccgtc gattacgtca        60
     acggtcatag atgatctcga aaacgtcaga gagtacgatg ccgacgacga cggaggacat       120
     tatccgttga ttttccgtga gttcagttta gaacagctga gaatcgccac cgacggtttc       180
     tccgccggaa acatcgtatc ggagcacaac gattcggtac caaacatcgt ctacaaagga       240
     aaactcggcg atggtcgtcg catcgccgtc aaacggtttc aaagactttc ttggcctgat       300
     cctttcgaat tcatcaatga agcacaagct gttgggagat tgaggagtga acatatggcg       360
     aatttgatcg gttgttgttg tgatgacaac gagagattac ttgttgctga gtatatgcct       420
     aatggaacat tagcaaaaca tctttttcac tgggagaaaa gacccatgaa atgggaaatg       480
     aggttgaaag ttgctctgca tactgcaaga gctttggagt attgtaatga taaaggaatt       540
     gatttatacc atgatcttaa tccttacagg attatgtttg ataagacagg gattcctaag       600
     ctttcttgct ttggtctcat gaagaatagc catgaaggga agatttatag caccaactta       660
     gcttttgctc ctcccgagta tttgcgcctt ggtactgtga tagcggagag cgtcacattt       720
     agctttggaa ccttgttatt ggatcttatg agcggcagac atattcctcc aaaccatgca       780
     cttgatttgt tccgtggcaa aaactatttg gtgctaatgg attcagctct tgatggtcag       840
     ttctctgatg aagacaggac agaactaata cacgtagctt ctcgatgttt caagactgaa       900
     ccagaagaga ggccaagtat aaagtttctt aaggcgactc tttctagact tcagaaacgg       960
     gccaagttgt gccctattaa tgtcaaaaga cctatgtctc ctccatcaaa aaatctgcct      1020
     gaaaagacta aacctgcaac agagtcattg aagttgactc ctttcggaga tgcatgttct      1080
     agagcggatc taagtagtat acatgaacta ctagagaaac tagggtatga agaagataat      1140
     ggggttggta acgagttttc attccaaatg tggaccggcg aaatgcaaga gaatatggac      1200
     tacaagaagc atggagatgc cgcgtttctt gcgaaagatt ttgatactgc cattgaattc      1260
     tacacagagt tcatgactgg agctcctacg gtatcaccaa cagtattggc aagaaggtgt      1320
     ctttgttacc taatgactga aatgttcagc gaggctctaa gcgatgcgat gcaagcgcaa      1380
     gtagcttcac cggaatggcc aattcctctt tacttacaag cggcttgtct cttcaagcta      1440
     gagatggaag ctgaagctaa agaagcactt agacatggtt ctgctcttga ggcttattag      1500
//

If you have problems or comments...

PBIL Back to PBIL home page