(data stored in ACNUC13479 zone)

EMBL: CP002688.CAX4

CP002688.CAX4        Location/Qualifiers
FT   CDS_pept        join(195589..195876,195984..196051,196160..196188,
FT                   196453..196649,196782..197003,197099..197239,
FT                   197328..197444,197543..197596,197823..197939,
FT                   198024..198114,198204..198240,198462..198465)
FT                   /codon_start=1
FT                   /gene="CAX4"
FT                   /gene_synonym="ATCAX4"
FT                   /gene_synonym="cation exchanger 4"
FT                   /gene_synonym="F7A7.10"
FT                   /gene_synonym="F7A7_10"
FT                   /locus_tag="AT5G01490"
FT                   /product="cation exchanger 4"
FT                   /note="cation exchanger 4 (CAX4); CONTAINS InterPro
FT                   DOMAIN/s: Sodium/calcium exchanger membrane region
FT                   (InterPro:IPR004837), Calcium/proton exchanger superfamily
FT                   (InterPro:IPR004798), Calcium/proton exchanger
FT                   (InterPro:IPR004713); BEST Arabidopsis thaliana protein
FT                   match is: cation exchanger 1 (TAIR:AT2G38170.3); Has 3152
FT                   Blast hits to 2978 proteins in 994 species: Archae - 25;
FT                   Bacteria - 1749; Metazoa - 60; Fungi - 737; Plants - 238;
FT                   Viruses - 0; Other Eukaryotes - 343 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q945S5"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q945S5"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV547983.1,INSD:DR369119.1,INSD:EL045687.1"
FT                   /protein_id="AED90352.1"
FT                   /translation="MSSISTESSSNLSLLENGGGGSDKPTAETSRRVRRTVSASSLIRK
FT                   RSDLKLISRVRWEFMRRILTNLQEVLLGTKLFILFPAVPLAVVAHRYDCPRAWVFALSL
FT                   LGLTPLAERISFLTEQIAFHTGPTVGGLMNATCGNATEMIIAILAVGQRKMRIVKLSLL
FT                   GSILSNLLFVLGTSLFLGGISNLRKHQSFDPRQGDMNSMLLYLALLCQTLPMIMRFTME
FT                   AEEYDGSDVVVLSRASSFVMLIAYLAFLIFHLFSSHLSPPPPPLPQREDVHDDDVSDKE
FT                   EEGAVIGMWSAIFWLIIMTLLVALLSDYLVSTIQDAADSWGLSVGFIGIILLPIVGNAA
FT                   EHAGAVIFAFRNKLDITLGIALGSATQIALFVVPVTVLVAWTMGIEMDLNFNLLETACF
FT                   ALSILVTSLVLQDGTSNYMKGLVLLLCYVVIAACFFVSNSPSTETNTTNHTITKR"
     atgtcttcaa tcagtacgga atcgtcttct aatctgtctc tgttagagaa tggcggagga        60
     ggaagtgata agccgacggc ggagacgtcg aggcgtgtgc ggagaacggt atcggcgtcg       120
     tcgttgataa ggaagagatc ggatctgaaa ctgatctcca gagttcgttg ggagtttatg       180
     agacgaatct tgacgaatct tcaagaagtt cttctcggca ccaaattgtt catcctcttc       240
     ccggccgttc ctctcgccgt cgtcgctcac cgctatgact gtccacgtgc gtgggtcttt       300
     gcgttgagct tgctgggatt gacacctttg gccgaacgta tcagttttct caccgagcaa       360
     attgctttcc ataccggtcc aacagttgga ggattaatga acgccacatg tggaaacgca       420
     acggagatga taatagcgat tctagcggtt gggcaaagga agatgagaat agtgaaactc       480
     tcacttcttg gctctattct ctccaatctt ctcttcgtct taggcacttc tctattcctt       540
     ggtggcatct ctaatctccg caaacaccaa tctttcgacc caagacaggg agatatgaac       600
     agcatgttgt tgtatctggc gctgttatgt cagacactac caatgataat gagattcaca       660
     atggaggctg aagaatacga tgggtcagat gtagttgtgt tgtcaagagc aagcagcttc       720
     gtgatgctca ttgcttactt ggcttttctc atctttcacc tcttctcttc tcatctctct       780
     cctcctcctc ctcctcttcc tcagagggag gacgtgcatg acgatgacgt gagtgacaag       840
     gaagaagaag gagccgtgat tggaatgtgg agtgcgattt tttggcttat tataatgaca       900
     cttctcgttg ctttgctctc agactacctt gtctccacta tccaggacgc agcagactcg       960
     tggggattat cagtgggatt cataggaata atattattac caattgttgg taatgcagct      1020
     gagcatgctg gtgctgtcat cttcgccttc cgtaacaaac tcgatataac tcttggaatt      1080
     gctcttggat ctgcaacaca aattgctttg ttcgtggtac cagtgacagt gttagtggca      1140
     tggacaatgg gaatagaaat ggaccttaac ttcaaccttc ttgagaccgc ttgttttgcc      1200
     ttgtccattc ttgttacttc cttagtatta caggatggga cttcgaacta tatgaaaggc      1260
     ttggttctcc tcttgtgtta tgttgtcata gcggcctgct tctttgtctc taactcaccc      1320
     tcaaccgaaa ccaatacaac taatcataca ataacgaaaa ggtaa                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page