(data stored in ACNUC13479 zone)

EMBL: CP002688.CHX26

CP002688.CHX26       Location/Qualifiers
FT   CDS_pept        complement(join(253996..254238,254315..255202,
FT                   255287..256297,256428..256640))
FT                   /codon_start=1
FT                   /gene="CHX26"
FT                   /gene_synonym="ARABIDOPSIS THALIANA CATION/HYDROGEN
FT                   EXCHANGER 26"
FT                   /gene_synonym="ATCHX26"
FT                   /gene_synonym="cation/H+ exchanger 26"
FT                   /gene_synonym="F7A7.200"
FT                   /gene_synonym="F7A7_200"
FT                   /locus_tag="AT5G01680"
FT                   /product="cation/H+ exchanger 26"
FT                   /note="cation/H+ exchanger 26 (CHX26); FUNCTIONS IN:
FT                   monovalent cation:hydrogen antiporter activity,
FT                   sodium:hydrogen antiporter activity; INVOLVED IN: cation
FT                   transport; LOCATED IN: integral to membrane; EXPRESSED IN:
FT                   male gametophyte, leaf, pollen tube; CONTAINS InterPro
FT                   DOMAIN/s: Cation/H+ exchanger (InterPro:IPR006153); BEST
FT                   Arabidopsis thaliana protein match is: cation/H+ exchanger
FT                   27 (TAIR:AT5G01690.1); Has 1807 Blast hits to 1807 proteins
FT                   in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
FT                   Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
FT                   339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M008"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M008"
FT                   /protein_id="AED90376.1"
FT                   /translation="MNNSVTSNGTHEFVCEAWLGSSSGGLLRGDDPLKYSTPLLLLLIS
FT                   LVSSLSSVFQALLRPLANVDFVTQILAGIFLGPSALGQNIDLVKKLFNTRSYFIIESFE
FT                   AISFMFISYISTAQVDMGVIKRGGKLAIINGLSLFLFPYVVGAIACTVITSNIRGTVAK
FT                   NNPEQLHNLLTNQSVVYFQVAYSVLSNLKMLNSEPGRLALSSIMVANCFGWGFFLLLIT
FT                   FDSFLHQNYSKTTYLPTFTKVLLLVGIVVVCRPIFNWIVKRTPEGKKLKASHLCTICVM
FT                   LCTATFLSETVGFPYVVGSVALGLVTPKTPPFGTGLTDKIGSFCYAVLMPCYVIGIGNK
FT                   VDFFSFNLRDIISLEFLIFTISAAKFASIVLPSLYFQVPISHAVIVGFIVCIQGIYDVQ
FT                   IFKQLLNYKNISHEAFGIMVISAMVHSTIFTAIVKNLYGWVQRKHITYRRQTVQHYEPN
FT                   KPLKILTCFYHRETVPPILTVLELSTCPSSASSHSIVSVNLEELEQNNVPLLIQHHPGH
FT                   NDESSTSSSRRDQISKAFEKFRSGHDLQENVSVECFTAVAPSKTMHEDVCALAFEKETD
FT                   LIIFGMADGTAAERRLCRNVRNASPSSVAVLMDQGRLPDFKNMGTAMKNGSMRINICSI
FT                   FLGGADDRETLAFAVRMTNQPYVNLTVLKLVDGENVSHLNDVVEKRLDFRTIEKFRQDT
FT                   MNKHNVALREVWIKEASDLVNLLREEGNNYDLIMVGIRHEKSFEVLQGLSVWSEIEELG
FT                   EIGDLLVSRDLKLSASVLAVQQQLSSVVEEV"
     atgaacaata gtgttacaag taatggcaca catgaatttg tatgcgaggc atggttggga        60
     tcaagctctg gcggattact tagaggagat gatccattga aatattcaac tcctcttctt       120
     cttcttctca tttctctcgt ctcttctctc tcttccgtct tccaagctct tctccgccct       180
     ctcgcaaatg tcgacttcgt cactcaaatt ctggctggga tattcttagg accctcggct       240
     ttgggacaaa acattgattt agtaaaaaaa ttattcaaca caagaagcta tttcataata       300
     gaatcatttg aggcaatatc cttcatgttc atctcataca taagcacggc tcaagtggac       360
     atgggagtta taaagcgagg aggcaagcta gcaatcatca atggattatc tctttttctg       420
     tttccttacg tggtgggcgc catagcatgt acagtaatca cgagcaacat ccgtggaacc       480
     gtggcgaaaa ataatcccga gcagctccac aatttactaa caaaccaatc cgtagtgtat       540
     tttcaagtgg cgtattcggt tttgtcgaat ctcaagatgc tgaactcgga gcccggaagg       600
     ttagccctct cctccataat ggtggctaac tgcttcggct ggggtttttt cctccttttg       660
     attacctttg acagtttctt gcatcaaaat tactccaaga ccacttatct gcctaccttc       720
     acaaaggtac tactgctggt tggtatagta gttgtgtgcc gaccaatatt caactggata       780
     gtgaagagaa cccctgaagg aaagaaactc aaggcttccc atctatgcac catttgcgtc       840
     atgttgtgca ccgccacttt cctgtctgaa actgtagggt ttccttacgt agtcggatcc       900
     gtggctctcg gtcttgtcac tcctaagacg cctcctttcg gtactggtct cactgacaag       960
     atcggtagct tctgttatgc ggttcttatg ccgtgttacg tcatcgggat tggtaacaaa      1020
     gtggatttct tttcattcaa tctacgcgac atcatatctt tggagttcct tatctttacc      1080
     attagtgctg caaagtttgc ctccatcgtc cttccatcgc tttacttcca agttcctata      1140
     tcacacgcag tgattgtcgg cttcatcgtc tgcatacaag ggatctacga tgtccaaatc      1200
     ttcaaacagc tcttgaacta caagaatata agccacgagg catttgggat aatggtgatc      1260
     tctgccatgg ttcactcgac cattttcacg gccattgtca aaaatctcta cgggtgggtg      1320
     cagaggaaac acatcactta ccggcgacaa accgttcaac actacgaacc aaacaaacct      1380
     ctcaagatcc tcacttgttt ctaccaccgt gaaaccgttc ctcccatcct caccgtcttg      1440
     gagctctcta cttgtccctc gagcgcctct tcgcactcca tcgtttccgt taatctcgaa      1500
     gagcttgagc aaaataacgt ccctctcctc attcaacacc atccaggtca caacgacgag      1560
     tcatcaacgt cttccagccg cagagatcag atctccaaag ccttcgagaa attccgaagc      1620
     ggccacgatt tgcaagaaaa cgtttccgtt gaatgtttca cagcagttgc accgagcaag      1680
     acgatgcacg aggatgtatg tgccttggcc ttcgaaaaag aaaccgatct catcattttc      1740
     gggatggccg acgggactgc agcagaacga aggctctgtc gcaacgtccg gaatgcctca      1800
     cctagctccg ttgcggttct aatggaccaa ggacggcttc cagatttcaa gaacatggga      1860
     acggcgatga agaacggctc aatgagaatc aacatctgtt caatattcct cggtggagca      1920
     gacgaccgtg agacactggc ctttgcggtt agaatgacaa accaacctta cgtaaaccta      1980
     accgttctta aacttgtcga cggtgaaaac gtctcacacc taaacgacgt cgtagagaaa      2040
     agactcgatt tcagaaccat cgaaaaattc cgtcaagaca ccatgaacaa acacaatgtc      2100
     gctttacgag aggtatggat aaaggaagcg agtgatctgg tgaacctact gagagaggaa      2160
     ggtaacaatt acgatctgat catggttgga atcagacacg aaaaaagttt cgaagtgctt      2220
     caaggattat cggtatggag tgagatcgag gagcttggag agatcggaga tctgctcgtt      2280
     tccagggatc tcaagctttc tgcatcggtt ttggccgtac aacaacaact ctcctctgtc      2340
     gtcgaggagg tttaa                                                       2355
//

If you have problems or comments...

PBIL Back to PBIL home page