(data stored in ACNUC13479 zone)

EMBL: CP002688.CHX27

CP002688.CHX27       Location/Qualifiers
FT   CDS_pept        join(257410..257628,257769..258281,258516..259013,
FT                   259096..259953,260130..260345)
FT                   /codon_start=1
FT                   /gene="CHX27"
FT                   /gene_synonym="ARABIDOPSIS THALIANA CATION/HYDROGEN
FT                   EXCHANGER 27"
FT                   /gene_synonym="ATCHX27"
FT                   /gene_synonym="cation/H+ exchanger 27"
FT                   /gene_synonym="F7A7.210"
FT                   /gene_synonym="F7A7_210"
FT                   /locus_tag="AT5G01690"
FT                   /product="cation/H+ exchanger 27"
FT                   /note="cation/H+ exchanger 27 (CHX27); BEST Arabidopsis
FT                   thaliana protein match is: cation/H+ exchanger 26
FT                   (TAIR:AT5G01680.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01690"
FT                   /db_xref="GOA:Q9M007"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M007"
FT                   /protein_id="AED90377.2"
FT                   /translation="MENITKTFQYGGVDWLCEPWVGAGSLGIGRGENPLKFALPLLLLQ
FT                   ISVFSIFSVSFQFLLRPFGKFAFLTQMLAGICLGPSVIGRNKQYMATFFYARSVYIIES
FT                   FEAICFLFICYITTCQVDTRMIKRVGKLAFINGILLFLIPFVWGQFAAILISKRLKSGP
FT                   AGIPPVEFHHVAIVQSTMFFQVVYGVLSSLKMLNTEPGRLALASMMVHDCLSWCFFMLN
FT                   IAIKLNVDLPNKNRAAFLSVLQMIMILVIAYVFRPLMLWMKNRTPEGHSLKASYLSVIC
FT                   VLLFISCLWAEFVGLPYFFGAVVLGLATPKRPPLGTGLSDKIGCFVWSVLMPCYVIGIG
FT                   LNIDLSLFSWRDVIRFELLFGVVRFAKMIAIALPSLYYKVPLWHAILVGFIVNIQGLYD
FT                   VQIYKQNFNYTKISSKSFGAMVMSATVNSTIFIVIVKKLYQTMSKRNPYKRRTVQHCRV
FT                   EAPLRILTCFRNREAVRPVLDLVELSRPAIGSPLSVFAVNLEELNNHSLPLLIHHTQEI
FT                   SPFLVPSRRDQIVKAFHNFEKTNQETVLIECFTAVAPRKTMHEDVCAIAFDQETDIVIL
FT                   TLDAGIELWERLLCRNLLHNCPCSVALFIDRGRLPDFRFVPLKKLTINIGAIFLGGPDD
FT                   REMLAYATRLASHPSVELQVFRLVDQNGVSPLRDMVERNHDMRVINVFRKENSEKNIIF
FT                   REVRIEEAVNLLDLLRKEGDDFDLMMVGIRHEENLLMLEGLSEWSDMKELGEVGDVLIS
FT                   KDLELSVSVLAVQQ"
     atggaaaata taaccaaaac ttttcagtac ggaggagttg attggctttg cgagccatgg        60
     gtaggtgcag gctctttggg gattggccgg ggagagaatc cgctcaagtt tgctcttcct       120
     cttcttctcc ttcagatttc tgtcttttcc atattttccg tatcttttca gtttcttctt       180
     cggccttttg gaaaatttgc attcctcact cagatgctgg ctgggatctg cttaggaccg       240
     tccgttatag gacgtaacaa acagtacatg gctacattct tctacgcgag aagcgtgtac       300
     ataatcgaat ccttcgaggc catatgtttt ctcttcattt gctacatcac aacatgtcaa       360
     gtagacacta ggatgataaa gagagtaggc aagttagcat tcataaacgg catcttactt       420
     ttcctcatac ctttcgtatg gggccaattc gcggccatct tgatctccaa gaggctcaaa       480
     agcgggcctg cggggatccc tcccgtggag ttccaccatg tagcgatcgt ccagtccaca       540
     atgttttttc aggtggttta cggagtcttg tcgagcctaa agatgttgaa cactgagcca       600
     gggaggttag cacttgcatc catgatggtg catgactgcc tctcttggtg ttttttcatg       660
     cttaacatcg ccattaaact taatgttgac ttacccaata aaaatcgcgc tgctttcttg       720
     tccgtcttac agatgataat gatattggtg atagcatatg tgttccgacc actaatgctg       780
     tggatgaaga atcgaacacc agaaggacac tctctcaagg cctcctatct ctctgttata       840
     tgcgtcttgc tcttcatctc ctgcctctgg gcagaatttg tgggtttacc ttacttcttt       900
     ggtgcggtcg tcttaggtct agccacccca aaacgtccgc ctctaggcac gggactgtca       960
     gacaaaatcg gttgttttgt ttggtctgtc ctgatgcctt gctacgtcat tgggattggc      1020
     ctcaatatcg atctctcact gttttcctgg agagatgtta tccggtttga gctacttttt      1080
     ggggtggtca ggtttgccaa aatgatagcc attgccttgc cttcccttta ctataaagtg      1140
     cctctttggc acgccattct tgtcgggttt atcgtcaata tacaaggact ttacgacgtt      1200
     caaatataca aacagaattt caattacacg aaaatatcaa gcaaatcttt tggagcaatg      1260
     gtgatgtcag caacggtaaa ctcgacaatt ttcatagtga tagtgaagaa actgtaccaa      1320
     accatgagca aacgcaaccc ttacaagaga cgtacggtgc aacactgccg agtggaggct      1380
     cccctaagga tcctcacttg tttccggaac cgtgaggcgg tccgcccggt gcttgacctc      1440
     gtcgaactct ctcgtccagc catcgggtct cctctctcag tcttcgcggt gaatctagaa      1500
     gagcttaata accatagtct tcccctcctt atccatcaca cgcaagagat tagtcccttc      1560
     ctcgtgccta gccgaaggga ccagatcgtt aaggccttcc acaacttcga gaagactaat      1620
     caggagaccg tgttgataga gtgcttcacg gcagtggcac cgcgaaagac gatgcacgag      1680
     gacgtgtgtg cgattgcctt tgaccaggaa acagatattg tgatcctaac tcttgatgcc      1740
     gggatcgagt tatgggagag gctcctgtgt cgtaatctcc tgcacaactg tccctgctct      1800
     gttgcgcttt tcatagacag aggaaggctc ccagatttca ggttcgttcc actgaaaaag      1860
     cttaccatca atattggtgc tatcttctta ggaggaccag atgaccgtga aatgcttgcg      1920
     tatgcaacac gcttagccag ccatccaagc gtcgagctcc aagtcttccg gctcgtggac      1980
     cagaacggcg tctctccgct cagagacatg gtcgagagga atcacgacat gagagtcatc      2040
     aacgtcttcc gcaaagaaaa ttccgagaaa aacatcatct tcagagaggt aagaatagag      2100
     gaagcagtga atctactgga tctactaagg aaggaagggg acgacttcga tctgatgatg      2160
     gtcgggataa gacacgaaga aaatcttttg atgttggaag gattgtcaga atggagcgat      2220
     atgaaggagt taggagaggt tggagatgtg ttgatctcca aagatctcga gctctctgtt      2280
     tcggttctcg ccgtacagca atga                                             2304
//

If you have problems or comments...

PBIL Back to PBIL home page