(data stored in ACNUC13479 zone)

EMBL: CP002688.CIPK15

CP002688.CIPK15      Location/Qualifiers
FT   CDS_pept        310460..311725
FT                   /codon_start=1
FT                   /gene="CIPK15"
FT                   /gene_synonym="ATPK10"
FT                   /gene_synonym="CBL-interacting protein kinase 15"
FT                   /gene_synonym="PKS3"
FT                   /gene_synonym="PROTEIN KINASE 10"
FT                   /gene_synonym="SERINE/THREONINE PROTEIN KINASE 10"
FT                   /gene_synonym="SIP2"
FT                   /gene_synonym="SMALL AND BASIC INTRINSIC PROTEIN 2"
FT                   /gene_synonym="SNF1-RELATED PROTEIN KINASE 3.1"
FT                   /gene_synonym="SNRK3.1"
FT                   /gene_synonym="SOS3-INTERACTING PROTEIN 2"
FT                   /gene_synonym="T20L15.80"
FT                   /gene_synonym="T20L15_80"
FT                   /locus_tag="AT5G01810"
FT                   /product="CBL-interacting protein kinase 15"
FT                   /note="CBL-interacting protein kinase 15 (CIPK15); CONTAINS
FT                   InterPro DOMAIN/s: Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase
FT                   domain (InterPro:IPR002290), NAF/FISL domain
FT                   (InterPro:IPR018451), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), NAF domain
FT                   (InterPro:IPR004041), CBL-interacting protein kinase
FT                   (InterPro:IPR020660), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Calcium/calmodulin-dependent protein
FT                   kinase-like (InterPro:IPR020636); BEST Arabidopsis thaliana
FT                   protein match is: SOS3-interacting protein 1
FT                   (TAIR:AT5G58380.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:P92937"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P92937"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:ES018919.1,INSD:DR379310.1,INSD:AU237397.1,
FT                   INSD:AV525606.1,INSD:AA605419.1,INSD:BP654359.1,
FT                   INSD:BP810542.1,INSD:T13762.1,INSD:EL218677.1,
FT                   INSD:EL024734.1,INSD:EL230005.1,INSD:BP828286.1,
FT                   INSD:ES108963.1,INSD:AU228447.1,INSD:AV539575.1,
FT                   INSD:BP646999.1,INSD:BP834356.1,INSD:EH984511.1,
FT                   INSD:EL232861.1,INSD:BP802304.1,INSD:EL024470.1,
FT                   INSD:EL060892.1,INSD:ES165951.1,INSD:EL158213.1,
FT                   INSD:EH831676.1,INSD:BP855286.1,INSD:BP651430.1,
FT                   INSD:EL235817.1,INSD:R90018.1,INSD:DR261305.1,
FT                   INSD:ES203344.1,INSD:EH983318.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT028964.1,INSD:AK228889.1,INSD:AF339144.1,
FT                   INSD:D30622.1,INSD:AF302111.1"
FT                   /protein_id="AED90394.1"
FT                   /translation="MEKKGSVLMLRYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDK
FT                   ERILKVGMTEQIKREISAMRLLRHPNIVELHEVMATKSKIYFVMEHVKGGELFNKVSTG
FT                   KLREDVARKYFQQLVRAVDFCHSRGVCHRDLKPENLLLDEHGNLKISDFGLSALSDSRR
FT                   QDGLLHTTCGTPAYVAPEVISRNGYDGFKADVWSCGVILFVLLAGYLPFRDSNLMELYK
FT                   KIGKAEVKFPNWLAPGAKRLLKRILDPNPNTRVSTEKIMKSSWFRKGLQEEVKESVEEE
FT                   TEVDAEAEGNASAEKEKKRCINLNAFEIISLSTGFDLSGLFEKGEEKEEMRFTSNREAS
FT                   EITEKLVEIGKDLKMKVRKKEHEWRVKMSAEATVVEAEVFEIAPSYHMVVLKKSGGDTA
FT                   EYKRVMKESIRPALIDFVLAWH"
     atggagaaga aaggatctgt gttgatgctc cgttatgagg ttgggaagtt tctcggtcaa        60
     ggtacctttg ctaaggtata ccatgctagg catttgaaaa ctggtgatag tgtagcgatt       120
     aaggtcatcg acaaagaaag aatcctcaaa gttggcatga ccgagcagat taagcgagag       180
     atctctgcca tgagactctt gaggcatccc aacatcgttg agctccatga agtcatggcc       240
     accaaatcta aaatctactt cgtcatggaa catgttaagg gtggtgagct cttcaacaaa       300
     gtgtcaactg ggaagctgag agaagacgtt gcgagaaagt actttcagca gcttgtacgc       360
     gctgttgact tctgtcacag ccgtggagta tgccacaggg acctgaagcc ggagaatctc       420
     ttgttggatg agcatgggaa tcttaagatc tctgattttg gtctcagcgc tctttctgac       480
     tctagaaggc aagacgggtt gctgcatact acatgcggga cccctgcata tgttgcaccg       540
     gaggtgataa gcaggaacgg gtatgatggg tttaaagcgg atgtgtggtc ctgtggagtg       600
     atattgttcg tcttgctcgc tggatatctt cctttccgtg attccaatct gatggagctg       660
     tataagaaga taggcaaagc tgaagtcaag ttccccaact ggcttgctcc gggggcaaag       720
     agattgctca agaggatctt ggatcctaac cccaacacaa gggtatcaac tgagaaaata       780
     atgaagagct cttggttccg taaaggccta caagaggagg tgaaagaatc agttgaggaa       840
     gagacagaag tggacgcaga ggcagaggga aacgcaagtg cagagaagga aaagaagcgg       900
     tgtatcaacc tgaacgcgtt tgagatcata tctctgtcca cggggtttga tctctcggga       960
     ctgttcgaga agggagagga gaaggaggag atgaggttta catcaaacag agaggcatct      1020
     gagataacag agaagctggt ggagattggg aaggacctta agatgaaagt gaggaagaag      1080
     gaacacgaat ggagggtgaa aatgtcggct gaggctacag tggtggaagc ggaagtgttt      1140
     gagattgcgc cgagctatca catggtggtg ctaaagaaga gcggtggaga tactgctgag      1200
     tataagagag tcatgaagga gagtataaga ccggctttga tcgactttgt attagcttgg      1260
     cactga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page