(data stored in ACNUC13479 zone)

EMBL: CP002688.CPL2

CP002688.CPL2        Location/Qualifiers
FT   CDS_pept        complement(join(107943..107958,108167..108311,
FT                   108451..108547,108636..108689,108768..108901,
FT                   109159..109210,109285..109595,109705..109837,
FT                   109954..110046,110133..110238,110330..110400,
FT                   110497..110654,110932..111142,111308..111778,
FT                   111871..112143))
FT                   /codon_start=1
FT                   /gene="CPL2"
FT                   /gene_synonym="ATCPL2"
FT                   /gene_synonym="carboxyl-terminal domain (ctd)
FT                   phosphatase-like 2"
FT                   /gene_synonym="F7J8.250"
FT                   /gene_synonym="F7J8_250"
FT                   /locus_tag="AT5G01270"
FT                   /product="carboxyl-terminal domain (ctd) phosphatase-like
FT                   2"
FT                   /note="carboxyl-terminal domain (ctd) phosphatase-like 2
FT                   (CPL2); FUNCTIONS IN: double-stranded RNA binding,
FT                   phosphatase activity; INVOLVED IN: response to auxin
FT                   stimulus, response to osmotic stress, developmental growth;
FT                   LOCATED IN: intracellular; EXPRESSED IN: 25 plant
FT                   structures; EXPRESSED DURING: 14 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Double-stranded RNA-binding
FT                   (InterPro:IPR001159), Double-stranded RNA-binding-like
FT                   (InterPro:IPR014720), NLI interacting factor
FT                   (InterPro:IPR004274); BEST Arabidopsis thaliana protein
FT                   match is: C-terminal domain phosphatase-like 1
FT                   (TAIR:AT4G21670.1)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01270"
FT                   /db_xref="GOA:F4K802"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:F4K802"
FT                   /protein_id="AED90321.1"
FT                   /translation="MNRLGHKSVVYHGDLRLGELDVNHVSSSHEFRFPNDEIRIHHLSP
FT                   AGERCPPLAILQTIASFAVRCKLESSAPVKSQELMHLHAVCFHELKTAVVMLGDEEIHL
FT                   VAMPSKEKKFPCFWCFSVPSGLYDSCLRMLNTRCLSIVFDLDETLIVANTMKSFEDRIE
FT                   ALKSWISREMDPVRINGMSAELKRYMDDRMLLKQYIDNDYAFDNGVLLKAQPEEVRPTS
FT                   DGQEKVCRPVIRLPEKNTVLTRIKPEIRDTSVLVKLRPAWEELRSYLTAKTRKRFEVYV
FT                   CTMAERDYALEMWRLLDPEAHLISLKELRDRIVCVKPDAKKSLLSVFNGGICHPKMAMV
FT                   IDDRMKVWEDKDQPRVHVVSAYLPYYAPQAETALVVPHLCVARNVACNVRGYFFKEFDE
FT                   SLMSSISLVYYEDDVENLPPSPDVSNYVVIEDPGFASNGNINAPPINEGMCGGEVERRL
FT                   NQAAAADHSTLPATSNAEQKPETPKPQIAVIPNNASTATAAALLPSHKPSLLGAPRRDG
FT                   FTFSDGGRPLMMRPGVDIRNQNFNQPPILAKIPMQPPSSSMHSPGGWLVDDENRPSFPG
FT                   RPSGLYPSQFPHGTPGSAPVGPFAHPSHLRSEEVAMDDDLKRQNPSRQTTEGGISQNHL
FT                   VSNGREHHTDGGKSNGGQSHLFVSALQEIGRRCGSKVEFRTVISTNKELQFSVEVLFTG
FT                   EKIGIGMAKTKKDAHQQAAENALRSLAEKYVAHVAPLARETEKGPENDNGFLWESSEDV
FT                   SNKGLEEEAPKENISELVLRK"
     atgaatcgtt tgggtcataa atccgtggtt tatcacggag atttacgttt gggggaactt        60
     gatgtgaacc atgtatcttc aagtcatgaa tttcgattcc cgaacgatga gattcgaatc       120
     caccatctat ctccggctgg tgagagatgt cctccgctcg cgattcttca gacgattgct       180
     tcttttgccg ttcgatgcaa gcttgagtca tcggctccgg tgaaatctca agagttaatg       240
     catctacacg cagtctgttt ccatgaattg aagactgcag tggttatgct cggagatgag       300
     gagattcatt tagtggcgat gccgagtaag gagaagaagt tcccgtgttt ttggtgtttt       360
     tcggttcctt caggtcttta tgattcgtgc ttaaggatgc ttaatactcg gtgtttgtct       420
     attgtgtttg atttggatga gactttgatt gttgcaaata ctatgaagtc atttgaggat       480
     agaatcgagg ctcttaaatc ttggatttca cgtgagatgg atcctgtgag gattaatggg       540
     atgtcagcag aacttaaaag gtatatggat gataggatgc tgctgaagca gtatattgat       600
     aatgactatg cttttgataa cggagttttg ttaaaggctc aacctgagga agtccgccca       660
     acttctgatg gacaagagaa agtttgtaga cccgtgatta gattgccgga gaagaatact       720
     gtgcttactc ggattaagcc agagatccgt gacactagtg tgcttgtaaa actgagacca       780
     gcatgggagg agttaagaag ttatttgaca gccaaaacta ggaaacgttt tgaagtttac       840
     gtttgtacca tggctgaaag ggattatgct ctggaaatgt ggagactgct tgatccggaa       900
     gcacacttga taagtctcaa ggagcttcga gatcgtatcg tctgcgtaaa accagacgcc       960
     aagaaatcgt tgttaagtgt cttcaatggt ggcatttgcc acccgaaaat ggcaatggtc      1020
     attgatgacc gtatgaaggt ttgggaggac aaggatcaac cacgggttca tgttgtttct      1080
     gcatatcttc cttattatgc tccacaagca gagacagccc ttgtcgttcc acatctctgc      1140
     gtagcaagaa atgttgcatg caatgtcaga ggttactttt tcaaggaatt tgatgagagt      1200
     ttaatgagta gtatatcttt ggtttactat gaagatgatg tggaaaattt acctccatca      1260
     ccggatgtga gcaactacgt cgttatagag gatcctggct ttgcttcaaa tggaaacata      1320
     aatgctcctc caattaacga aggaatgtgt gggggtgaag tggaacgaag actaaaccaa      1380
     gcggctgcag ctgatcattc tactcttcct gcaacaagta acgctgagca gaaacctgaa      1440
     acccctaagc cgcagatagc agttatacca aataatgcaa gcacggcaac tgcagcagca      1500
     ctgttacctt ctcataaacc tagtttgctt ggagctccta ggcgggatgg cttcactttt      1560
     tctgatggtg gaagacccct tatgatgagg cctggtgtag atataaggaa ccaaaacttt      1620
     aatcaacccc ccattctggc taaaattcct atgcagccac cttcctcgtc tatgcattct      1680
     ccgggtggtt ggttggtaga tgatgagaat agaccttctt ttcctggtcg gccttcagga      1740
     ctttatccaa gtcaatttcc tcatggaaca ccaggttctg ctcctgttgg tccatttgca      1800
     catccatccc acttgaggag tgaagaggta gcaatggatg atgacctgaa aaggcaaaat      1860
     ccttcacgtc aaacaacaga aggtggaata tcccagaatc atttggtgtc aaatggtaga      1920
     gaacatcata cagatggtgg aaagagtaat ggcgggcaat ctcatttatt tgtgagtgca      1980
     ctgcaagaaa ttggaagaag atgtggttca aaggtggagt ttaggactgt gataagtacc      2040
     aacaaagagt tacagttttc agttgaggtg ttgttcacgg gtgagaagat aggcattggg      2100
     atggcaaaaa ctaagaaaga tgcacatcaa caagcggctg agaatgctct tcgaagtttg      2160
     gctgaaaagt atgttgcaca tgtggcacct ctagctagag aaacagagaa aggtccggaa      2220
     aatgataatg gatttttgtg ggaaagcagt gaagatgtat caaacaaagg acttgaagag      2280
     gaagcgccta aagaaaacat ttcagagtta gttttgagaa agtga                      2325
//

If you have problems or comments...

PBIL Back to PBIL home page