(data stored in ACNUC13479 zone)

EMBL: CP002688.ESP4

CP002688.ESP4        Location/Qualifiers
FT   CDS_pept        complement(join(162803..163505,163615..163718,
FT                   163809..163892,163996..164040,164121..164192,
FT                   164295..164375,164517..164612,164685..164759,
FT                   164845..164892,164996..165079,165167..165274,
FT                   165352..165414,165520..165669,165790..165888,
FT                   165970..166017,166265..166507,166582..166698,
FT                   166988..167056,167391..167936,168051..168605,
FT                   168711..168836,169035..169206,169645..169813,
FT                   169924..169999,170082..170174,170284..170443,
FT                   170870..171084))
FT                   /codon_start=1
FT                   /gene="ESP4"
FT                   /gene_synonym="ENHANCED SILENCING PHENOTYPE 4"
FT                   /gene_synonym="T10O8.110"
FT                   /gene_synonym="T10O8_110"
FT                   /locus_tag="AT5G01400"
FT                   /product="HEAT repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01400"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022075"
FT                   /db_xref="InterPro:IPR032460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8B9H4"
FT                   /protein_id="ANM68245.1"
FT                   /translation="MVGIMASYSRARLKDLANSAKSATELPPKLQRLRYMRRDLQKDDS
FT                   VFPTELLPHLFDLLSDQFGAVRKFVAEILGEIGLKYVELIPEIVPLLIKSLEDETPAVA
FT                   RQVIACGADLFRSTLERVAVQGLHSSELNDLLESSWTWLIKFKDEICSVAFKQGNSGVK
FT                   LCAMKFVEALILLYTPHEGIEADFNISILRGGHPVLKIGDLSIEASQKLGLLLDQLRHP
FT                   AAKSLNSSTIIVLINSLSSVAKKRPAYCGRILPVLLSLDPLSFLKGVYAAATNLALKTV
FT                   FLSCLKCTHPAAAPWKDRLTSALKEIEGGGQAAKAKDLFYKTNGSIQDKDSVEDTKVSV
FT                   EENPLCASSDVAESNLSRKRSGSEYNIDLNGDASDGKRARITPSVSEESTDGLNGNDGV
FT                   SLPRVASTSTGPSDSRGVSDSGPAQQLVGLFGTLVSQGEKAIGSLEILISSISADLLTD
FT                   VVMANMHNIPPNCSSYADGTDELVMNMCIVGSDAQIKYPPSFVAGVLSLSTAFPPIAAL
FT                   INPHNEDEEVYSVHVDQQMFPAEDARTPPGLLATCDTSFPENEESNTVSPQNVHYIGNR
FT                   ESGIPGLESSAQHDGSGALVTNVLSSTNVEAASKNQNASFSGKLLVDVIPSMSVDKLEE
FT                   FSPKAVGTVASASQFVLPKISAPVVDLSDEEKDSLQKLVFLRIVEAYKQISMSGGSQLR
FT                   FSLLAHLGVEFPSELDPWKILQEHVLSDYLNHEGHELTVRVLYRLYGEAEAEQDFFSST
FT                   TAASAYESFLLTVAEALRDSFPPSDKSLSKLLGDSPHLPKSVLMLLESFCCPGSGEVEK
FT                   DLQHGDRVTQGLSAVWSLILMRPGIRNDCLNIALQSAVHHLEEIRMKAIRLVANKLYSL
FT                   SFITEQIEEFAKDRLFSVVSDDCDKMDLDLKSPPNKPQHSISGMSMETPSEATSSSTSV
FT                   TEAQRCLSLYFALCTKKHSLFVHVFSIYKNASDPVKQAIHLQIPILVRTMGSSSELLKI
FT                   IADPPSGSDNLLIQVLQTLTEGPTPSSELILTIRKLFDTRIKDVEILFPILPFLPRDDV
FT                   LRIFPHMVNLPMEKFQVALSRVLQGSSQSGPVLSPSEALIAIHSIDPARDGIPLKQVTD
FT                   ACNTCFAQRQTFTQQVLAGVLNQLVQQIPLPMLFMRTVLQAIGAFPALSDFILEILSRL
FT                   VSKQIWKYPKLWVGFLKCTQTTQPQSYKVLLQLPPLQLGNALTKIPALRAPLTAHASQP
FT                   EIQSSLPRSTLAVLGLVPDSQGTQTSQVQANETQTSQEQQQQQASEPQQTSQSQQVSVP
FT                   LSHSQVDHQEPSQVVASQSQSSPIGTVQSAMSQSQNSPIDTGRSEMSQSQNSPIDTGRS
FT                   EMSQSQNSPIDTGRSEMSQSQNSPIDTGRSEMSESQSSPIGQSQSSPIGTGQSDMSQTP
FT                   QVSDSSAPEPTSHTRTSDPQASSQTLRDDDEKIDDTATSENEVTEIEKSKESSEEEEEE
FT                   EEEEE"
     atggttggaa tcatggcttc gtattcaaga gcaaggctta aagatctcgc gaattccgcc        60
     aaatcagcga cggaattgcc tcccaagctg caacgcttgc gctatatgcg ccgggatttg       120
     caaaaagacg attccgtttt tcccacggag ttgcttcctc accttttcga tcttctctcc       180
     gatcaattcg gtgctgtccg caagtttgtc gccgagatac ttggtgaaat tggcctgaaa       240
     tatgtggaat taatacctga aatagtgccc cttttaatta agtctcttga agatgagaca       300
     ccagctgtgg ccaggcaggt cattgcttgt ggagctgatt tattccgttc caccctcgaa       360
     agagtggcag ttcagggttt gcattctagt gagttgaatg atcttcttga atcttcatgg       420
     acatggttga ttaagttcaa ggatgaaata tgctcagtgg ctttcaagca aggaaatagt       480
     ggtgtaaaat tatgcgctat gaaatttgtg gaagcgctta ttctcttgta tactcctcat       540
     gaaggaattg aagcagattt taatatatct attctccgtg ggggtcatcc tgttttgaaa       600
     attggagatt tgtcaattga ggccagccag aaattgggtt tactgcttga tcagcttagg       660
     caccctgcag caaaatctct aaatagctcg acgattattg ttcttatcaa tagtctttca       720
     tcagttgcaa agaaacgtcc tgcatactgt ggacgaattc tacctgttct actgagcttg       780
     gatcccctaa gctttctcaa aggagtgtat gctgcagcaa caaatcttgc cttgaagact       840
     gtatttctct cctgcttgaa atgtacacat cccgctgctg caccgtggaa ggaccggttg       900
     accagtgctc ttaaagagat agaaggtgga ggtcaggcag ccaaagcgaa agatctcttt       960
     tacaagacta acggaagcat tcaggacaaa gacagtgtag aagataccaa ggtatcagtg      1020
     gaagagaatc ctctctgtgc aagttctgat gtagcagaaa gtaacttaag taggaaaaga      1080
     tctggatcag aatacaatat tgatctaaat ggagatgctt ccgatggaaa acgtgcaaga      1140
     ataacacctt ctgtgtcaga agaatccact gacggattaa atggtaatga tggggtctct      1200
     ctacctcggg ttgcttctac ctcgaccgga ccaagtgata gcagaggagt gagtgatagt      1260
     ggacctgctc agcagctagt tggtttgttt ggaaccttgg tttctcaggg tgaaaaagca      1320
     attggatctt tggagattct tatttcaagt atttcggcgg atttacttac tgatgttgtg      1380
     atggctaata tgcataatat tccaccaaat tgttcttctt atgctgatgg caccgatgag      1440
     ttggtgatga acatgtgtat agttggcagt gatgcacaaa ttaaatatcc accatcattt      1500
     gtagcgggtg tcctttcatt gtcaaccgca ttcccaccaa ttgctgccct gataaatcct      1560
     cacaatgaag atgaggaagt ctattctgtt catgtggacc agcaaatgtt tccagctgaa      1620
     gatgcaagaa ctccacctgg cttattagct acctgtgata cttcttttcc agaaaatgaa      1680
     gaaagcaata ctgtgtctcc acaaaatgtg cattacatag ggaatagaga aagtggaata      1740
     cctggactgg aatcttctgc tcaacatgat gggtcaggag cccttgttac taatgtattg      1800
     agttctacga atgtggaggc tgcaagcaaa aatcaaaatg cgagtttcag tggaaaactt      1860
     cttgtcgatg taattccctc aatgtctgtg gataagttgg aggaatttag tccaaaggcg      1920
     gttggcacag ttgcttcggc gagtcagttt gtcttaccta agatatcagc acctgttgtc      1980
     gacctttctg atgaagagaa agacagttta caaaagctgg tttttttgcg cattgttgaa      2040
     gcatataagc aaatatcaat gtctggtggc tcacaactcc gcttttctct tcttgctcat      2100
     ttaggagttg agtttccttc agagttagac ccttggaaaa tattacagga gcacgttctc      2160
     tcggattatt tgaatcatga gggacatgag ttgactgtgc gggttcttta caggctatac      2220
     ggggaggcag aagcagaaca agatttcttc tcttcaacta ctgctgcgtc tgcatatgaa      2280
     agtttcttgc taactgtggc tgaagcacta agagattctt ttccaccgtc tgacaaatct      2340
     ttaagtaaat tgcttggaga ttctccacat ctgccgaaat cagttctgat gttgttggaa      2400
     tcgttttgct gtcctggaag tggtgaagtt gaaaaggatt tacaacatgg agaccgtgtt      2460
     actcaaggtc tcagtgctgt ttggagcctg attttaatga gacctggaat ccggaatgac      2520
     tgcctgaata tcgctttgca gagtgctgtt catcacttgg aagagattcg catgaaagca      2580
     atccgcctgg tggcaaacaa actctattct ttatcattca ttacagaaca gattgaggaa      2640
     tttgcaaagg ataggctatt ttctgtcgta agtgatgatt gtgataagat ggatcttgat      2700
     ctgaaaagtc caccaaacaa accgcaacac agtattagtg gtatgagtat ggagacgccc      2760
     tccgaagcaa catcatcatc aacttcagtt actgaagctc aacgctgctt gtcactctat      2820
     tttgctctct gtaccaagaa gcactccctt tttgttcatg tattcagcat atacaagaat      2880
     gcatcagatc ccgttaagca ggctattcat cttcaaatcc ctattctagt tcgtactatg      2940
     ggctcatcct ctgagcttct taaaattata gcagacccac caagtgggag tgacaacctt      3000
     cttatacagg ttcttcaaac cctcaccgag gggcccactc cttcttcaga attgatactt      3060
     actatacgga agttgtttga tacaagaata aaggatgtag agattctttt cccaattttg      3120
     ccattcctgc caagagatga tgttctccgc atttttcccc atatggtgaa tcttcctatg      3180
     gagaaattcc aagttgcact ttctcgtgtg ctgcagggat catctcaatc tggcccagtg      3240
     ctttctccat ctgaagcttt aattgctatc catagcattg acccagcaag agatggaata      3300
     ccacttaaac aggtcacaga tgcatgcaat acctgttttg cgcagaggca gacattcact      3360
     caacaggttt tagccggtgt tctgaatcaa ctggtccagc aaattccact gccaatgtta      3420
     ttcatgcgta cagttttaca agctattggt gcttttccag ctctgtcgga cttcatcctg      3480
     gagattcttt ctcgtctcgt tagcaaacag atatggaaat atccgaaact gtgggttggg      3540
     tttttgaaat gcacacagac aacacagcct caatcatata aggtcttact acagcttcct      3600
     ccacttcaac tgggaaacgc attgactaaa atcccggcct taagagctcc gctaaccgca      3660
     catgccagcc agccagagat tcaatcttca cttccaaggt ctacattggc tgttcttgga      3720
     cttgtccctg attctcaagg aacacaaaca agccaagtgc aagcgaatga gacacaaacg      3780
     agtcaggaac agcagcaaca gcaagcaagc gagccacagc aaacgagcca gtctcagcaa      3840
     gtttctgtac cattgagcca ctcccaagta gatcaccagg aacccagtca ggtagttgcc      3900
     agtcagtctc aaagcagtcc catagggacc gtccagtcag caatgagtca gtctcagaac      3960
     agtcccatag atacgggccg gtctgaaatg agtcagtctc agaacagtcc catagatacg      4020
     ggccggtctg aaatgagtca gtctcagaac agtcccatag atacgggccg gtctgaaatg      4080
     agtcagtctc agaacagtcc catagatacg ggaagatctg aaatgagtga atctcagagc      4140
     agtcctattg gtcagtcaca aagcagtcct attggtactg gccagtctga tatgagtcaa      4200
     acccctcaag tgtcggactc gagtgctcca gaaccaacaa gccatactcg gacatcagat      4260
     cctcaagcgt caagccagac actacgagat gatgatgaga agatagacga cacagcaacc      4320
     tcagaaaacg aggtgacaga aatcgagaaa tcaaaagaat cttccgaaga agaagaagaa      4380
     gaagaagaag aagaagagtg a                                                4401
//

If you have problems or comments...

PBIL Back to PBIL home page