(data stored in ACNUC13479 zone)

EMBL: CP002688.FER1

CP002688.FER1        Location/Qualifiers
FT   CDS_pept        complement(join(228149..228183,228272..228335,
FT                   228429..228494,228590..228651,228753..228840,
FT                   228941..229001,229114..229197,229287..229594))
FT                   /codon_start=1
FT                   /gene="FER1"
FT                   /gene_synonym="ARABIDOPSIS THALIANA FERRETIN 1"
FT                   /gene_synonym="ATFER1"
FT                   /gene_synonym="ferretin 1"
FT                   /locus_tag="AT5G01600"
FT                   /product="ferretin 1"
FT                   /note="ferretin 1 (FER1); FUNCTIONS IN: ferric iron
FT                   binding, iron ion binding; INVOLVED IN: in 12 processes;
FT                   LOCATED IN: thylakoid, chloroplast thylakoid membrane,
FT                   chloroplast stroma, chloroplast, membrane; EXPRESSED IN: 25
FT                   plant structures; EXPRESSED DURING: 15 growth stages;
FT                   CONTAINS InterPro DOMAIN/s: Ferritin, N-terminal
FT                   (InterPro:IPR001519), Ferritin-related
FT                   (InterPro:IPR012347), Ferritin-like (InterPro:IPR009040),
FT                   Ferritin, conserved site (InterPro:IPR014034),
FT                   Ferritin/ribonucleotide reductase-like
FT                   (InterPro:IPR009078), Ferritin/Dps protein
FT                   (InterPro:IPR008331); BEST Arabidopsis thaliana protein
FT                   match is: ferritin 4 (TAIR:AT2G40300.1); Has 1807 Blast
FT                   hits to 1807 proteins in 277 species: Archae - 0; Bacteria
FT                   - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0;
FT                   Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q39101"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q39101"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP797874.1,INSD:EH979537.1,INSD:EL073210.1,
FT                   INSD:BP816148.1,INSD:AV794321.1,INSD:BP817364.1,
FT                   INSD:BP560425.1,INSD:BP860204.1,INSD:ES014884.1,
FT                   INSD:BP592920.1,INSD:AV538677.1,INSD:EH856702.1,
FT                   INSD:BP841146.1,INSD:ES194421.1,INSD:AV824748.1,
FT                   INSD:EL095908.1,INSD:ES192958.1,INSD:EG487886.1,
FT                   INSD:BP815895.1,INSD:ES067962.1,INSD:BP805663.1,
FT                   INSD:AV806232.1,INSD:T04388.1,INSD:BP566435.1,
FT                   INSD:BP831265.1,INSD:AV796351.1,INSD:CK121416.1,
FT                   INSD:BP822013.1,INSD:BP661563.1,INSD:AA597366.1,
FT                   INSD:BP856254.1,INSD:ES166090.1,INSD:CB252417.1,
FT                   INSD:EL194740.1,INSD:BP632283.1,INSD:BP662030.1,
FT                   INSD:DR269953.1,INSD:AV535334.1,INSD:AV805648.1,
FT                   INSD:AV562066.1,INSD:EH877560.1,INSD:AV813381.1,
FT                   INSD:ES079349.1,INSD:EL284016.1,INSD:BP819416.2,
FT                   INSD:EG470686.1,INSD:BP655311.1,INSD:AV798328.1,
FT                   INSD:EH836858.1,INSD:DR370128.1,INSD:AV564705.1,
FT                   INSD:ES209040.1,INSD:BP832154.1,INSD:AV562617.1,
FT                   INSD:EH930890.1,INSD:DR269956.1,INSD:AV535957.1,
FT                   INSD:BP585560.1,INSD:BP810361.1,INSD:AV538072.1,
FT                   INSD:EG499974.1,INSD:EL160307.1,INSD:EH934272.1,
FT                   INSD:BP654467.1,INSD:EL999105.1,INSD:BP806424.2,
FT                   INSD:BP580340.1,INSD:ES187020.1,INSD:EH960949.1,
FT                   INSD:AI997778.1,INSD:ES085762.1,INSD:EH881232.1,
FT                   INSD:BP560959.1,INSD:ES196236.1,INSD:BP810315.1,
FT                   INSD:BP834986.1,INSD:BE521679.1,INSD:EH970502.1,
FT                   INSD:CK119363.1,INSD:BP640954.1,INSD:BP827683.1,
FT                   INSD:EL301410.1,INSD:BP819095.1,INSD:BP662544.1,
FT                   INSD:AV811046.1,INSD:EL149555.1,INSD:EL026621.1,
FT                   INSD:BP626937.1,INSD:EG470683.1,INSD:BP590189.1,
FT                   INSD:BP859687.1,INSD:CB258647.1,INSD:ES017254.1,
FT                   INSD:BP609131.1,INSD:ES191511.1,INSD:EL330029.1,
FT                   INSD:CK121876.1,INSD:ES124115.1,INSD:BP625953.1,
FT                   INSD:EL329119.1,INSD:BP845929.1,INSD:BP646760.1,
FT                   INSD:ES006023.1,INSD:BP860612.1,INSD:AV560343.1,
FT                   INSD:BP825595.2,INSD:DR269950.1,INSD:BP563456.1,
FT                   INSD:EL307118.1,INSD:BP856220.1,INSD:BP820048.1,
FT                   INSD:BP609436.1,INSD:BP821859.1,INSD:ES025478.1,
FT                   INSD:BP600938.1,INSD:BP586770.1,INSD:BP625670.1,
FT                   INSD:BP846074.1,INSD:BP857184.1,INSD:EL975874.1,
FT                   INSD:BP635438.1,INSD:BP859791.1,INSD:BP826907.1,
FT                   INSD:CB255259.1,INSD:AV785072.1,INSD:AV794252.1,
FT                   INSD:BP816337.1,INSD:BP567509.1,INSD:EG525532.1,
FT                   INSD:BP817680.1,INSD:BP834387.1,INSD:AV807258.1,
FT                   INSD:BP613355.1,INSD:EL149543.1,INSD:BP809325.1,
FT                   INSD:ES213334.1,INSD:AV815665.1,INSD:EG490027.1,
FT                   INSD:Z18156.1,INSD:BP831465.1,INSD:ES083624.1,
FT                   INSD:EH882205.1,INSD:ES097901.1,INSD:EL074981.1,
FT                   INSD:BP669507.1,INSD:ES030295.1,INSD:DR269951.1,
FT                   INSD:BP849105.2,INSD:CK119275.1,INSD:EG499976.1,
FT                   INSD:BP641849.1,INSD:EH893147.1,INSD:EG490028.1,
FT                   INSD:AV781358.1,INSD:EG522002.1,INSD:BP619422.1,
FT                   INSD:BP608335.1,INSD:BP651772.1,INSD:EH929694.1,
FT                   INSD:BP668442.1,INSD:EH884615.1,INSD:BP622037.1,
FT                   INSD:BE521680.1,INSD:BE844770.1,INSD:EH817469.1,
FT                   INSD:EL197986.1,INSD:BP819314.1,INSD:EL967890.1,
FT                   INSD:AV550220.1,INSD:BP657921.1,INSD:BP573643.1,
FT                   INSD:BP858424.1,INSD:BP590721.1,INSD:ES057102.1,
FT                   INSD:DR269954.1,INSD:BP820380.1,INSD:DR269947.1,
FT                   INSD:AV814866.1,INSD:CB257060.1,INSD:EL128033.1,
FT                   INSD:AV564739.1,INSD:EL300525.1,INSD:ES200955.1,
FT                   INSD:ES046008.1,INSD:BP856389.1,INSD:BP788691.1,
FT                   INSD:CB258963.1,INSD:EG523356.1,INSD:AV562546.1,
FT                   INSD:T42999.1,INSD:EH994988.1,INSD:EL204684.1,
FT                   INSD:BP588596.1,INSD:BP862986.1,INSD:BP571556.1,
FT                   INSD:BP617314.1,INSD:AV520721.1,INSD:EH860758.1,
FT                   INSD:DR269949.1,INSD:EG522003.1,INSD:EL982599.1,
FT                   INSD:AV441450.1,INSD:BP840633.1,INSD:BP831821.1,
FT                   INSD:EG481093.1,INSD:ES134179.1,INSD:ES214042.1,
FT                   INSD:EL974389.1,INSD:EH847154.1,INSD:EL267021.1,
FT                   INSD:EH891317.1,INSD:EL989508.1,INSD:BP844218.1,
FT                   INSD:T42023.1,INSD:AV560198.1,INSD:H37125.1,
FT                   INSD:EL069379.1,INSD:ES033298.1,INSD:EG488074.1,
FT                   INSD:BP650949.1,INSD:BP583353.1,INSD:AV557595.1,
FT                   INSD:BP841312.1,INSD:EL080897.1,INSD:BP649234.1,
FT                   INSD:EH841385.1,INSD:BP596709.1,INSD:EL074366.1,
FT                   INSD:ES043863.1,INSD:EL980930.1,INSD:BP589913.1,
FT                   INSD:ES151513.1,INSD:EL026516.1,INSD:BP595619.1,
FT                   INSD:T75606.1,INSD:CK119920.1,INSD:AV815804.1,
FT                   INSD:BP566589.1,INSD:BP863563.1,INSD:R64909.1,
FT                   INSD:BP563108.1,INSD:BP601579.1,INSD:BP854231.1,
FT                   INSD:BP861167.1,INSD:BP816671.1,INSD:BP824349.1,
FT                   INSD:BP671952.1,INSD:EL981070.1,INSD:BP666940.1,
FT                   INSD:BP654472.1,INSD:EL998576.1,INSD:DR269952.1,
FT                   INSD:EL064157.1,INSD:CK118115.1,INSD:BP836002.1,
FT                   INSD:EL275290.1,INSD:R86990.1,INSD:EH993315.1,
FT                   INSD:ES171814.1,INSD:ES076814.1,INSD:ES049091.1,
FT                   INSD:BP806131.1,INSD:AV809712.1,INSD:EL172942.1,
FT                   INSD:BP568263.1,INSD:BP621116.1,INSD:BP845329.1,
FT                   INSD:EG448548.1,INSD:BP604364.1,INSD:ES137834.1,
FT                   INSD:ES210817.1,INSD:BP818903.1,INSD:BP810006.2,
FT                   INSD:ES009937.1,INSD:BP833966.1,INSD:ES208448.1,
FT                   INSD:EL282324.1,INSD:BP843402.1,INSD:EG455144.1,
FT                   INSD:CD531964.1,INSD:BP781865.1,INSD:EG488085.1,
FT                   INSD:AV534494.1,INSD:EH865880.1,INSD:EL243281.1,
FT                   INSD:CD532714.1,INSD:EG455143.1,INSD:EL099544.1,
FT                   INSD:EL974150.1,INSD:ES161600.1,INSD:BP641191.1,
FT                   INSD:BP638206.1,INSD:BP845747.2,INSD:DR269955.1,
FT                   INSD:BP592385.1,INSD:BP649103.1,INSD:EG525534.1,
FT                   INSD:BP651373.1,INSD:EL038973.1,INSD:EL183283.1,
FT                   INSD:T45167.1,INSD:BP651874.1,INSD:ES132107.1,
FT                   INSD:EG520919.1,INSD:BP622742.1,INSD:BP657885.1,
FT                   INSD:BP824396.1,INSD:BP841252.1,INSD:BP625567.1,
FT                   INSD:AV553061.1,INSD:BP846350.1,INSD:BP840866.1,
FT                   INSD:EG448546.1,INSD:AV811958.1,INSD:BP842200.1,
FT                   INSD:BP859857.1,INSD:BP861364.2,INSD:BP843027.1,
FT                   INSD:Z30743.1,INSD:BP825262.2,INSD:DR269944.1,
FT                   INSD:BP560619.1,INSD:AV804569.1,INSD:AV562570.1,
FT                   INSD:EL970554.1,INSD:BP614111.1,INSD:AV565909.1,
FT                   INSD:ES177293.1,INSD:EL299935.1,INSD:EL334094.1,
FT                   INSD:BP628068.1,INSD:EL187175.1,INSD:BP840744.1,
FT                   INSD:BP659304.1,INSD:BP836907.1,INSD:BP857235.1,
FT                   INSD:CB255822.1,INSD:EL097395.1,INSD:BP867524.1,
FT                   INSD:AV784079.1,INSD:BP824954.1,INSD:BP798558.1,
FT                   INSD:ES026608.1,INSD:EH897465.1,INSD:BP800471.1,
FT                   INSD:EL037899.1,INSD:EH821718.1,INSD:BP670484.1,
FT                   INSD:BP638989.1,INSD:BP826928.1,INSD:BP802108.1,
FT                   INSD:EH978118.1,INSD:BP669013.1,INSD:EL147017.1,
FT                   INSD:BP811040.1,INSD:AV531795.1,INSD:DR269945.1,
FT                   INSD:BP638289.1,INSD:CF652310.1,INSD:ES124554.1,
FT                   INSD:BP605648.1,INSD:AV823972.1,INSD:AB050569.1,
FT                   INSD:ES197536.1,INSD:BP818773.1,INSD:BP641643.1,
FT                   INSD:BP820902.1,INSD:ES072116.1,INSD:ES012217.1,
FT                   INSD:ES050601.1,INSD:BP640637.1,INSD:EG471925.1,
FT                   INSD:EL145369.1,INSD:ES014864.1,INSD:ES147814.1,
FT                   INSD:BP832274.1,INSD:BP805829.1,INSD:ES155601.1,
FT                   INSD:BP827447.1,INSD:EL968460.1,INSD:AV818210.1,
FT                   INSD:ES164286.1,INSD:BP812589.1,INSD:AV527160.1,
FT                   INSD:ES023308.1,INSD:BP605075.1,INSD:ES179658.1,
FT                   INSD:BP572945.1,INSD:BP638159.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF339691.1,INSD:AK220892.1,INSD:BX829583.1,
FT                   INSD:BX830797.1,INSD:BX841654.1,INSD:AY084509.1,
FT                   INSD:X94248.1,INSD:AF326869.1,INSD:AF412065.1,
FT                   INSD:AK226433.1"
FT                   /protein_id="AED90364.1"
FT                   /translation="MASNALSSFTAANPALSPKPLLPHGSASPSVSLGFSRKVGGGRAV
FT                   VVAAATVDTNNMPMTGVVFQPFEEVKKADLAIPITSHASLARQRFADASEAVINEQINV
FT                   EYNVSYVYHSMYAYFDRDNVAMKGLAKFFKESSEEERGHAEKFMEYQNQRGGRVKLHPI
FT                   VSPISEFEHAEKGDALYAMELALSLEKLTNEKLLNVHKVASENNDPQLADFVESEFLGE
FT                   QIEAIKKISDYITQLRMIGKGHGVWHFDQMLLN"
     atggcctcaa acgcactctc gtctttcacc gccgctaatc ccgctctgtc tcctaagcca        60
     ctactccctc acggctctgc ttctccgtcg gtttctctcg gcttctccag gaaagttggc       120
     ggcggcagag cagtggtcgt tgcagcggct acggtggaca caaacaacat gccgatgacc       180
     ggagtcgtgt tccagccttt cgaagaggtg aagaaagccg atctggccat tccaatcaca       240
     tctcatgcct ctctcgctcg ccagaggttt gccgacgcta gcgaggcagt cattaatgag       300
     caaatcaatg tggaatacaa cgtctcctat gtgtaccatt caatgtacgc atactttgac       360
     agagacaacg ttgctatgaa gggactagcc aaatttttca aggaatcaag tgaggaagag       420
     agagggcatg ctgagaagtt tatggagtac cagaaccaaa gaggaggaag agtgaaactc       480
     caccctatcg tctcacctat ctcagaattc gaacatgctg aaaaaggaga tgctttatat       540
     gcaatggagt tggctctgtc tctagagaaa ctcactaatg agaagcttct aaacgttcac       600
     aaagtggcct cagagaacaa tgatccccag ttagctgatt tcgttgagag tgaatttctg       660
     ggagagcaga ttgaagcaat caagaagatc tcagactaca tcacccagct aaggatgatc       720
     ggcaaaggcc acggagtttg gcatttcgac cagatgcttc tgaactag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page