(data stored in ACNUC13479 zone)

EMBL: CP002688.FRB1

CP002688.FRB1        Location/Qualifiers
FT   CDS_pept        complement(join(34872..35133,35219..35695,35787..36019,
FT                   36122..36254,36327..36415,36497..36567,36656..36725,
FT                   37196..37756))
FT                   /codon_start=1
FT                   /gene="FRB1"
FT                   /gene_synonym="F7J8.80"
FT                   /gene_synonym="F7J8_80"
FT                   /gene_synonym="FRIABLE 1"
FT                   /locus_tag="AT5G01100"
FT                   /product="O-fucosyltransferase family protein"
FT                   /note="O-fucosyltransferase family protein; CONTAINS
FT                   InterPro DOMAIN/s: GDP-fucose protein O-fucosyltransferase
FT                   (InterPro:IPR019378); BEST Arabidopsis thaliana protein
FT                   match is: O-fucosyltransferase family protein
FT                   (TAIR:AT3G54100.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFC6"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="InterPro:IPR024709"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFC6"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP577816.1,INSD:AU226934.1,INSD:BP574125.1,
FT                   INSD:EG503413.1,INSD:ES189896.1,INSD:ES193829.1,
FT                   INSD:EG496316.1,INSD:EL193772.1,INSD:BP803799.1,
FT                   INSD:EG503412.1,INSD:AU236118.1,INSD:BP581712.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT046173.1,INSD:AK228227.1,INSD:BX832511.1"
FT                   /protein_id="AED90299.1"
FT                   /translation="MSVGVPVNPSSSSQLPAAPTTTTRRRVADSQEDHSHVNTVGGGNA
FT                   VVYVPDEEETATSCCGGGGGGGSLSCCPSGSHHNYLVGFLSLRKFRLVWMLMVENKSKW
FT                   TAGIARNMRSTTNLGRFILTLLSILVVTFFLIVALSGGVGRRRKHVEKHEFVVSIHPRP
FT                   TIEKIIREDESSNSFQVLVPKTTSIPEIWNQPEVGNYQKCVARPKNQRPIKQTNGYLLV
FT                   HANGGLNQMRTGICDMVAIAKIMNATLVLPFLDHSSFWSDPSSFKDIFDWKHFIKVLAE
FT                   DVNIVEYLPQEFASIKPLEKNPVSWSKSSYYRNSISKLLKKHKVIVFNHTDSRLANNSP
FT                   PPSIQRLRCRANYEALRYSEDIENLSNVLSSRLRENNEPYLALHLRYEKDMLAFTGCNH
FT                   SLSNEESIDLEKMRFSIPHWKEKVINGTERRLEGNCPMTPREAAVFLKAMGFPSTTNIY
FT                   IVAGKIYGQNSMTAFHEEFPNVFFHNTLATEEELSTIKPYQNRLAALDYNLALESDIFA
FT                   YTYDGNMAKAVQGHRRFEGFRKTINPDRQRFVRLIDRLDAGLISWEDFSSKVKKMHQHR
FT                   IGAPYLRQPGKAGMSPKLEENFYANPLPGCVCDTSEEQTGLNRFERPSLRAQSLR"
     atgtcagtcg gcgttccagt gaatccgtca agcagcagcc aactaccggc ggcgccaaca        60
     acaacaacaa gacggcgcgt ggctgattct caagaagatc attcccacgt caacaccgtc       120
     ggaggaggaa acgcagtcgt ttacgtcccc gacgaggaag aaaccgctac gagctgctgc       180
     ggcggaggag gaggaggagg atcattatcg tgttgtccaa gtggctccca ccacaattac       240
     ctcgtcgggt tcctctctct ccgaaaattc aggctcgtgt ggatgctaat ggttgagaac       300
     aaatctaaat ggacggctgg gattgctcgt aacatgagat ccacgaccaa tcttggccgt       360
     tttattctaa cgttattgag tatcctcgtc gtcacttttt tcctcatcgt tgctctctcc       420
     ggcggcgttg gaagacggag aaaacacgtt gagaaacatg aattcgttgt ttcaattcat       480
     cccagaccaa cgattgagaa aatcattaga gaagatgaat catccaattc ctttcaagtc       540
     ctcgttccaa aaactacatc gatcccagag atttggaatc aaccggaggt tgggaactat       600
     cagaaatgtg tagctcgtcc taagaaccaa agaccaatca agcaaaccaa tggttacctt       660
     cttgttcacg ccaatggtgg tttgaatcag atgagaactg gtatatgtga tatggtggca       720
     atcgctaaaa tcatgaacgc aactcttgtt cttccgtttc ttgaccattc atctttctgg       780
     agtgatccaa gctcgttcaa ggacattttc gactggaaac atttcataaa agtactagca       840
     gaagatgtca atattgtcga gtatttaccg caagaatttg cttcgattaa gcctcttgaa       900
     aagaatcctg tgtcctggtc taagtcgagt tattacagaa actcaatctc caagttactt       960
     aagaagcata aggtgattgt attcaatcac actgattctc ggctagccaa caacagtccg      1020
     cctccttcca tccagcggct tcgatgtcgc gcaaactatg aagctcttcg ttactctgaa      1080
     gatatagaga atctgagcaa tgttctctct tcaagactta gggaaaacaa cgaaccctac      1140
     ctcgctcttc acttgcggta cgagaaagat atgttggcgt ttaccggatg caatcacagt      1200
     ctatccaatg aagaatccat tgatcttgag aagatgaggt ttagtattcc acactggaaa      1260
     gaaaaagtga tcaatggtac agaacggcgt cttgaaggta attgccctat gacgccgcgt      1320
     gaagctgccg tcttcctcaa ggcgatgggg tttccttcga ccaccaatat ctacattgtt      1380
     gcaggaaaaa tctacgggca aaacagtatg actgcgttcc acgaagagtt cccaaacgtt      1440
     ttctttcaca acacattggc cacagaggaa gagctttcga ctattaaacc ttatcagaac      1500
     agattagctg ctcttgatta caatttagca ctcgaaagcg atattttcgc ttatacttat      1560
     gatggaaaca tggcgaaagc ggttcaaggt caccggagat tcgaagggtt tagaaaaacg      1620
     attaatcccg ataggcaaag attcgtgaga ttgattgatc ggctcgatgc aggactcata      1680
     tcttgggaag atttctcgtc aaaggttaag aagatgcatc agcatagaat aggagcaccg      1740
     tatcttaggc agccaggaaa ggcaggcatg agtccaaagt tagaggagaa tttttatgct      1800
     aaccctcttc ctggttgcgt gtgcgatacg tctgaggaac aaaccggcct taaccggttt      1860
     gaaagaccaa gtctacgagc acaatctctg agataa                                1896
//

If you have problems or comments...

PBIL Back to PBIL home page