(data stored in ACNUC13479 zone)

EMBL: CP002688.LAC8

CP002688.LAC8        Location/Qualifiers
FT   CDS_pept        complement(join(13394..13578,13703..14665,14764..14874,
FT                   15191..15435,15579..15730,16044..16142))
FT                   /codon_start=1
FT                   /gene="LAC8"
FT                   /gene_synonym="F7J8.20"
FT                   /gene_synonym="F7J8_20"
FT                   /gene_synonym="laccase 8"
FT                   /locus_tag="AT5G01040"
FT                   /product="laccase 8"
FT                   /note="laccase 8 (LAC8); FUNCTIONS IN: laccase activity;
FT                   INVOLVED IN: vegetative to reproductive phase transition of
FT                   meristem, response to copper ion; LOCATED IN: endomembrane
FT                   system, apoplast; EXPRESSED IN: fruit, root, flower;
FT                   CONTAINS InterPro DOMAIN/s: Multicopper oxidase, type 2
FT                   (InterPro:IPR011706), Multicopper oxidase, type 3
FT                   (InterPro:IPR011707), Laccase (InterPro:IPR017761),
FT                   Cupredoxin (InterPro:IPR008972), Multicopper oxidase, type
FT                   1 (InterPro:IPR001117); BEST Arabidopsis thaliana protein
FT                   match is: Laccase/Diphenol oxidase family protein
FT                   (TAIR:AT5G01050.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFD2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFD2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP628641.1,INSD:AV545019.1,INSD:EG510082.1,
FT                   INSD:BE525703.1,INSD:CB252826.1,INSD:AV539116.1,
FT                   INSD:EG510046.1,INSD:AV551119.1,INSD:AV544086.1,
FT                   INSD:EG510072.1,INSD:EG510080.1,INSD:EG510074.1,
FT                   INSD:EG510079.1,INSD:BP810741.1,INSD:AV553978.1,
FT                   INSD:BP605912.1,INSD:EG476895.1,INSD:AV553631.1,
FT                   INSD:EG510060.1,INSD:EG510048.1,INSD:AV548944.1,
FT                   INSD:EG476952.1,INSD:EL190154.1,INSD:BP616398.1,
FT                   INSD:AV784392.1,INSD:EG507809.1,INSD:AV542740.1,
FT                   INSD:EG510090.1,INSD:EL013148.1,INSD:EG426485.1,
FT                   INSD:BP801383.1,INSD:EG507815.1,INSD:BP616094.1,
FT                   INSD:AU229348.1,INSD:AV543742.1,INSD:EG507800.1,
FT                   INSD:EG510062.1,INSD:EG440606.1,INSD:EG510066.1,
FT                   INSD:AV548054.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX832359.1,INSD:BX832175.1"
FT                   /protein_id="AED90291.1"
FT                   /translation="MPRLHHYLSNQAFLVLLLFSSIASAAVVEHVLHIQDVVVKPLCKE
FT                   QIIPAANGSLPGPTINVREGDTLVVNVINNSTYNVTIHWHGVFQLKSVWMDGANMITQC
FT                   PIQPGYNFTYQFDITGQEGTLLWHAHVVNLRATLHGALVIRPRSGRPYPFPKPYKEVPI
FT                   VFQQWWDTDVRLLQLRPAPVSDAYLINGLAGDSYPCSENRMFNLKVVQGKTYLLRIVNA
FT                   ALNTHLFFKIANHNVTVVAVDAVYSTPYLTDVMILTPGQTVDALLTADQAIGKYYMATL
FT                   PYISAIGIPTPDIKPTRGLIVYQGATSSSSPAEPLMPVPNDMSTAHRFTSNITSLVGGP
FT                   HWTPVPRHVDEKMFITMGLGLDPCPAGTKCIGPLGQRYAGSLNNRTFMIPERISMQEAY
FT                   FYNISGIYTDDFPNQPPLKFDYTKFEQRTNNDMKMMFPERKTSVKKIRFNSTVEIVLQN
FT                   TAIISPESHPMHLHGFNFYVLGYGFGNYDPIRDARKLNLFNPQMHNTVGVPPGGWVVLR
FT                   FIANNPGVWLFHCHMDAHLPYGIMSAFIVQNGPTPETSLPSPPSNLPQCTRDPTIYDSR
FT                   TTNIDLSY"
     atgcctcgac ttcatcatta tctctcaaat caagcgttcc tcgtccttct tctcttctct        60
     tccattgcct cagcagctgt tgtcgaacat gttctccaca tccaagacgt cgtggtgaaa       120
     ccgttatgca aggagcaaat aataccggca gctaatggaa gtcttcccgg cccaacgata       180
     aacgttagag aaggcgacac tcttgtggtt aatgtcatta acaactcaac ttacaatgta       240
     accatccact ggcatggagt tttccagttg aagagcgtat ggatggacgg tgcgaatatg       300
     ataactcaat gtccgattca accaggttac aacttcacat atcaatttga tatcactgga       360
     caagaaggta cattgttatg gcacgcacac gtcgttaatc tacgtgccac tcttcacggg       420
     gctctagtca tccgtccccg atccggccgt ccttaccctt ttcctaaacc ctacaaggaa       480
     gttcctatcg tttttcaaca atggtgggac acagatgtta gacttctcca attacggcca       540
     gctccggttt ctgatgctta cctcatcaat ggcctcgccg gagattcata tccttgctct       600
     gagaatagaa tgtttaacct caaagttgta caaggaaaaa catacttgct aaggatcgta       660
     aacgcagcac tcaacactca cctcttcttc aaaatagcca atcacaacgt cacagttgtc       720
     gctgtagatg ctgtctactc gacgccgtac ctcaccgatg tgatgatctt aacgccggga       780
     cagaccgttg acgcacttct caccgccgac caggccattg gaaagtacta catggccacc       840
     ctcccttaca ttagtgccat tgggatacca acccccgaca tcaaacccac cagaggctta       900
     atcgtctacc agggtgccac gtcatcatca tcgccagcgg agccgttgat gcctgtgccg       960
     aatgacatgt ccaccgctca taggttcacc tcaaacatca ctagcctcgt tggtggacca      1020
     cactggacac cagtccctcg tcacgtggac gagaagatgt tcataaccat ggggcttggc      1080
     ttagacccat gtccagcggg caccaagtgt attggaccgt taggtcaaag gtatgctggt      1140
     tctctcaaca accgcacttt tatgatcccg gagagaatct ctatgcaaga ggcttatttt      1200
     tacaacatta gtggcatcta caccgacgat tttcccaacc aaccaccgct taaatttgat      1260
     tacacaaaat tcgaacaacg taccaataat gacatgaaga tgatgtttcc ggaaagaaag      1320
     actagcgtca agaaaattag atttaattct acagtcgaga tcgttttgca gaacacggct      1380
     ataatctccc cggagagcca ccccatgcac ctccacggtt tcaacttcta tgtgttaggt      1440
     tatggatttg gtaactatga tcctattcgt gatgcaagaa agcttaatct atttaacccg      1500
     caaatgcata ataccgttgg tgtaccacca ggcggatggg ttgtcctcag atttatcgct      1560
     aataatcctg gtgtatggct gttccattgt cacatggatg cacatttacc atacgggatt      1620
     atgagtgctt tcatagttca aaacgggcca actccggaaa cgagcttgcc atctccaccg      1680
     tcgaatcttc cgcaatgcac tcgggatcct acgatctatg actctcggac gactaacatt      1740
     gatttgtctt actaa                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page