(data stored in ACNUC13479 zone)

EMBL: CP002688.LAX1

CP002688.LAX1        Location/Qualifiers
FT   CDS_pept        join(98228..98419,98615..98803,98931..99043,99176..99359,
FT                   99441..99538,100118..100325,100634..100891,101269..101493)
FT                   /codon_start=1
FT                   /gene="LAX1"
FT                   /gene_synonym="F7J8.220"
FT                   /gene_synonym="F7J8_220"
FT                   /gene_synonym="like AUXIN RESISTANT 1"
FT                   /locus_tag="AT5G01240"
FT                   /product="like AUXIN RESISTANT 1"
FT                   /note="like AUXIN RESISTANT 1 (LAX1); CONTAINS InterPro
FT                   DOMAIN/s: Amino acid transporter, transmembrane
FT                   (InterPro:IPR013057); BEST Arabidopsis thaliana protein
FT                   match is: Transmembrane amino acid transporter family
FT                   protein (TAIR:AT2G38120.1); Has 1807 Blast hits to 1807
FT                   proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 736; Fungi - 347; Plants - 385; Viruses - 0; Other
FT                   Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01240"
FT                   /db_xref="GOA:Q9LFB2"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LFB2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP787325.1,INSD:BP825250.1,INSD:BP844502.1,
FT                   INSD:AV786500.1,INSD:BP780173.1,INSD:EH860636.1,
FT                   INSD:EH878879.1,INSD:EL083575.1,INSD:DR283805.1,
FT                   INSD:BP664740.1,INSD:EL112096.1,INSD:AV821463.1,
FT                   INSD:EL239235.1,INSD:BP855385.1,INSD:BP591839.1,
FT                   INSD:BP654245.1,INSD:BP664825.1,INSD:EH972697.1,
FT                   INSD:EL155919.1,INSD:BP819900.1,INSD:BP804266.1,
FT                   INSD:BP647266.1,INSD:AV790258.1,INSD:EL063314.1,
FT                   INSD:EL022068.1,INSD:EL240342.1,INSD:EL283994.1,
FT                   INSD:BP843961.1,INSD:EH835424.1,INSD:CF773448.1,
FT                   INSD:EH846141.1,INSD:EL072648.1,INSD:BP779699.1,
FT                   INSD:BP862111.1,INSD:EL163876.1,INSD:EL215878.1,
FT                   INSD:EL170376.1,INSD:EH819666.1,INSD:BP615918.1,
FT                   INSD:EH984785.1,INSD:BP856806.1,INSD:DR283806.1,
FT                   INSD:EL187318.1,INSD:BP644678.1,INSD:AV526808.1,
FT                   INSD:BP665586.1,INSD:BP587397.1,INSD:DR376289.1,
FT                   INSD:BP868011.1,INSD:EL261982.1,INSD:EL165075.1,
FT                   INSD:EH804336.1,INSD:BP638154.1,INSD:BP659331.1,
FT                   INSD:EL014164.1,INSD:EL155882.1,INSD:BP816398.1,
FT                   INSD:BP792310.1,INSD:EH984893.1,INSD:EL253395.1,
FT                   INSD:DR363559.1,INSD:AV781921.1,INSD:EG493607.1,
FT                   INSD:BP862271.1,INSD:EL106371.1,INSD:EH938681.1,
FT                   INSD:EL150053.1,INSD:BP857703.1,INSD:EL134083.1,
FT                   INSD:EL078195.1,INSD:EH922564.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX830652.1,INSD:BX831209.1,INSD:AJ249442.1,
FT                   INSD:BX830611.1"
FT                   /protein_id="AED90315.1"
FT                   /translation="MSGEKQAEESIVVSGEDEVAGRKVEDSAAEEDIDGNGGNGFSMKS
FT                   FLWHGGSAWDAWFSCASNQVAQVLLTLPYSFSQLGMLSGILLQIFYGLMGSWTAYLISV
FT                   LYVEYRARMEKQEAKSFKNHVIQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIAC
FT                   ASNIYYINDRLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLGMTTYTAWYLTIASF
FT                   LHGQAEGVTHSGPTKLVLYFTGATNILYTFGGHAVTVEIMHAMWKPRKFKSIYLMATLY
FT                   VFTLTLPSASAVYWAFGDQLLNHSNAFSLLPKTRFRDTAVILMLIHQFITFGFACTPLY
FT                   FVWEKAIGMHHTKSLCLRALVRLPVVVPIWFLAIIFPFFGPINSAVGALLVTFTVYIIP
FT                   ALAHMLTYRTASARRNAAEKPPFFIPSWAGVYVINAFIVVWVLVLGFGFGGWASMTNFI
FT                   RQIDTFGLFAKCYQCKPPPAPIAAGAHHRR"
     atgtcgggtg agaaacaagc ggaggagtca atagtagtct ccggggagga tgaggtggcc        60
     ggtagaaaag tggaagattc agcggcggag gaggatattg acggcaacgg gggcaatgga       120
     tttagtatga agagcttcct ctggcatggc gggtccgctt gggacgcctg gtttagctgt       180
     gcatcaaatc aagtggcaca agtgctgttg acgctgccgt attcgttctc gcagttggga       240
     atgttatcag gaatattgct tcaaatattc tatgggttaa tgggatcttg gactgcttat       300
     ctcatcagtg ttctttacgt cgagtatcgt gcccgtatgg agaaacaaga agccaaatcc       360
     ttcaaaaacc acgttattca atggtttgaa gtgcttgatg ggctgctggg tccgtactgg       420
     aaagcagcgg ggctcgcatt taattgcacc ttcttgttat tcggatcagt catccagctc       480
     attgcttgtg ctagcaatat atattacata aacgataggt tagacaagag gacatggact       540
     tatatatttg gggcttgctg tgccacgacc gttttcatac catctttcca caattaccgt       600
     atttggtctt tcctcggcct tggcatgacc acctacaccg cttggtacct caccatcgcc       660
     tcttttctcc atggtcaggc ggagggtgtg acacattccg gtccaaccaa gcttgtgttg       720
     tactttaccg gagccaccaa catcctctat accttcggtg gacacgctgt gaccgtggaa       780
     ataatgcatg cgatgtggaa accaaggaag tttaagagca tctacttgat ggcaactctg       840
     tacgtcttca cattaacgct tccgtcagcc tccgccgtct actgggcttt cggcgaccaa       900
     cttctcaacc actcaaacgc tttctctctc ctccctaaaa cgcgtttccg tgacaccgcc       960
     gttatcctca tgctcatcca tcagtttata acgttcgggt ttgcgtgtac accattgtac      1020
     ttcgtatggg aaaaagcgat cggaatgcac cacacaaaga gcttatgtct aagagcgctg      1080
     gtgaggctac cggtggtggt tccgatatgg tttttggcaa tcatctttcc ctttttcggg      1140
     ccaataaact cggcagttgg agccttactt gttaccttca ccgtctatat catccctgcc      1200
     ttagcccaca tgctcacgta ccgcaccgcc tctgcccgcc ggaacgcggc ggagaaacca      1260
     ccgtttttta tccctagctg ggctggagtt tacgtgataa acgctttcat agtggtttgg      1320
     gtcctagttc tcgggttcgg gtttggcgga tgggccagta tgaccaactt catcaggcaa      1380
     attgatactt ttggcctctt tgccaaatgc taccaatgca aaccacctcc agctccgatc      1440
     gccgccggag ctcaccaccg ccgttag                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page