(data stored in ACNUC13479 zone)

EMBL: CP002688.LECRKA4.1

CP002688.LECRKA4.1   Location/Qualifiers
FT   CDS_pept        complement(211285..213333)
FT                   /codon_start=1
FT                   /gene="LECRKA4.1"
FT                   /gene_synonym="F7A7.60"
FT                   /gene_synonym="F7A7_60"
FT                   /gene_synonym="lectin receptor kinase a4.1"
FT                   /gene_synonym="L-type lectin receptor kinase-VI.2"
FT                   /gene_synonym="LecRK-VI.2"
FT                   /locus_tag="AT5G01540"
FT                   /product="lectin receptor kinase a4.1"
FT                   /note="lectin receptor kinase a4.1 (LECRKA4.1); FUNCTIONS
FT                   IN: kinase activity; INVOLVED IN: N-terminal protein
FT                   myristoylation, abscisic acid mediated signaling pathway,
FT                   response to abscisic acid stimulus, seed germination;
FT                   LOCATED IN: plasma membrane; EXPRESSED IN: 17 plant
FT                   structures; EXPRESSED DURING: 10 growth stages; CONTAINS
FT                   InterPro DOMAIN/s: Legume lectin, beta chain
FT                   (InterPro:IPR001220), Protein kinase, ATP binding site
FT                   (InterPro:IPR017441), Serine/threonine-protein kinase-like
FT                   domain (InterPro:IPR017442), Concanavalin A-like
FT                   lectin/glucanase, subgroup (InterPro:IPR013320), Protein
FT                   kinase-like domain (InterPro:IPR011009),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Concanavalin A-like lectin/glucanase
FT                   (InterPro:IPR008985); BEST Arabidopsis thaliana protein
FT                   match is: lectin receptor kinase a4.1 (TAIR:AT5G01550.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:Q9M021"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M021"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH802774.1,INSD:EL292499.1,INSD:R64824.1,
FT                   INSD:BP816100.2,INSD:AV829852.1,INSD:BP815877.2,
FT                   INSD:AV808896.1,INSD:BP592177.1,INSD:BP592187.1,
FT                   INSD:BP829512.2,INSD:AU239076.2,INSD:N97302.1,
FT                   INSD:BP648184.1,INSD:EH913539.1,INSD:EL144779.1,
FT                   INSD:AU036593.1,INSD:EL249303.1,INSD:BP651454.1,
FT                   INSD:BP642570.1,INSD:BP645106.1,INSD:EH939393.1,
FT                   INSD:EL139251.1,INSD:BP653054.1,INSD:BP831842.1,
FT                   INSD:AU230346.1,INSD:BP835046.1,INSD:EL331798.1,
FT                   INSD:BP644703.1,INSD:AV827157.1,INSD:AI993877.1,
FT                   INSD:AV797394.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AF361597.1,INSD:BT000489.1"
FT                   /protein_id="AED90358.1"
FT                   /translation="MGTQRSMFIVSFLFKLFLFLSVHVRAQRTTTNFAFRGFNGNQSKI
FT                   RIEGAAMIKPDGLLRLTDRKSNVTGTAFYHKPVRLLNRNSTNVTIRSFSTSFVFVIIPS
FT                   SSSNKGFGFTFTLSPTPYRLNAGSAQYLGVFNKENNGDPRNHVFAVEFDTVQGSRDDNT
FT                   DRIGNDIGLNYNSRTSDLQEPVVYYNNDDHNKKEDFQLESGNPIQALLEYDGATQMLNV
FT                   TVYPARLGFKPTKPLISQHVPKLLEIVQEEMYVGFTASTGKGQSSAHYVMGWSFSSGGE
FT                   RPIADVLILSELPPPPPNKAKKEGLNSQVIVMIVALSAVMLVMLVLLFFFVMYKKRLGQ
FT                   EETLEDWEIDHPRRLRYRDLYVATDGFKKTGIIGTGGFGTVFKGKLPNSDPIAVKKIIP
FT                   SSRQGVREFVAEIESLGKLRHKNLVNLQGWCKHKNDLLLIYDYIPNGSLDSLLYTVPRR
FT                   SGAVLSWNARFQIAKGIASGLLYLHEEWEKIVIHRDVKPSNVLIDSKMNPRLGDFGLAR
FT                   LYERGTLSETTALVGTIGYMAPELSRNGNPSSASDVFAFGVLLLEIVCGRKPTDSGTFF
FT                   LVDWVMELHANGEILSAIDPRLGSGYDGGEARLALAVGLLCCHQKPASRPSMRIVLRYL
FT                   NGEENVPEIDDEWGYSKSSRSEFGSKLVGYVSSTSITRVSSTSRISQ"
     atgggcacac aaagatccat gttcatagtc tcattcttat tcaagctttt cctgtttttg        60
     agcgtccatg ttcgagctca gagaacaaca acaaattttg ctttccgagg ttttaacgga       120
     aaccaatcga agattcggat tgaaggagcc gcgatgatca aacccgacgg actattgaga       180
     ctcactgacc gaaagtcgaa tgttaccggt acagctttct accacaaacc ggtgaggttg       240
     cttaatagaa attccacaaa cgtcacaatt cgttccttta gcacgtcttt cgtctttgtc       300
     ataatccctt caagctcaag caataaaggc tttggattca cattcacact atctccaaca       360
     ccttatcgtc tcaatgctgg atccgcacag tacttgggag ttttcaacaa agagaacaat       420
     ggggatccta ggaaccacgt attcgcagtg gaattcgaca cggtgcaagg atcaagagac       480
     gacaacaccg acagaatagg aaacgacatc ggtctgaatt acaacagtcg tacttcggat       540
     ctccaagaac cagtcgtgta ttacaacaat gatgatcaca acaaaaaaga agatttccag       600
     cttgagagtg gcaatcctat tcaagccctt ttggagtatg atggagcaac acaaatgcta       660
     aacgtcaccg tttatcccgc gagattaggg tttaaaccca caaagccttt gatctctcaa       720
     catgttccaa aactgttgga gattgtgcaa gaagaaatgt acgtcggatt cacggcatcg       780
     acggggaaag gtcagtcaag tgctcattac gtgatgggtt ggagtttctc aagcggcgga       840
     gaacgtccaa ttgcggatgt tctaatcctc tcggagcttc ctccgccgcc gccgaataag       900
     gcgaagaagg aaggtttaaa ttctcaagtc attgttatga tcgtggcgtt atcggcagta       960
     atgctggtca tgcttgtgtt actcttcttc ttcgtcatgt acaagaagag actgggacaa      1020
     gaagagactc ttgaagactg ggaaatcgat catcctcgca gattgagata cagagacctc      1080
     tacgtagcca cggatggatt caaaaagact ggaatcatcg gaaccggagg atttggaacc      1140
     gttttcaaag gaaaactgcc gaattcggat cccatcgcag tgaagaagat aattccaagt      1200
     agcaggcaag gtgttcgaga atttgtcgca gagatcgaga gtttggggaa actaaggcat      1260
     aagaatctgg tgaacctcca aggatggtgc aaacacaaaa acgatctctt gttgatttac      1320
     gattacatcc ccaacggaag cttagactct ctgctctaca ctgtaccgag aagaagcggc      1380
     gccgttttgt cgtggaacgc tcgttttcag atcgctaaag gaatcgcgtc tggtttattg      1440
     tatcttcacg aagaatggga gaagattgtg attcatagag acgtgaaacc tagcaatgtc      1500
     ttgatcgatt caaagatgaa ccctagattg ggagattttg gactcgcgag gctttacgaa      1560
     cgcggaacgc tatcggaaac aacagcactc gttggaacca tcgggtacat ggcgccagag      1620
     ctttcccgca acggaaaccc ctcatctgcg tctgatgttt tcgcgtttgg cgttttgttg      1680
     ttagagatcg tttgcgggag aaaaccaacg gattccggta ccttcttctt ggtcgattgg      1740
     gttatggagc ttcacgcgaa cggtgagatt ctcagtgcga ttgatccgag actaggatct      1800
     ggttacgacg gaggagaagc aaggcttgct ctcgccgtcg gattgctctg ttgccaccaa      1860
     aaaccggcgt ctcggccgtc gatgagaatc gtgcttaggt atctaaacgg agaggagaat      1920
     gtacctgaga ttgacgatga gtggggatat tcaaagtctt caagaagcga attcggatcc      1980
     aagttggtag gatatgtttc gtcgacctca atcaccagag tttcttcgac ttctcgtatc      2040
     agtcagtag                                                              2049
//

If you have problems or comments...

PBIL Back to PBIL home page