(data stored in ACNUC13479 zone)

EMBL: CP002688.LECRKA4.2

CP002688.LECRKA4.2   Location/Qualifiers
FT   CDS_pept        complement(214517..216637)
FT                   /codon_start=1
FT                   /gene="LECRKA4.2"
FT                   /gene_synonym="F7A7.70"
FT                   /gene_synonym="F7A7_70"
FT                   /gene_synonym="lectin receptor kinase a4.1"
FT                   /gene_synonym="L-type lectin receptor kinase VI.3"
FT                   /gene_synonym="LecRK-VI.3"
FT                   /locus_tag="AT5G01550"
FT                   /product="lectin receptor kinase a4.1"
FT                   /note="lectin receptor kinase a4.1 (LECRKA4.2); FUNCTIONS
FT                   IN: protein serine/threonine kinase activity, binding,
FT                   protein kinase activity, kinase activity, ATP binding;
FT                   INVOLVED IN: abscisic acid mediated signaling pathway, seed
FT                   germination; EXPRESSED IN: 6 plant structures; EXPRESSED
FT                   DURING: 4 anthesis, petal differentiation and expansion
FT                   stage; CONTAINS InterPro DOMAIN/s: Legume lectin, beta
FT                   chain (InterPro:IPR001220), Protein kinase, ATP binding
FT                   site (InterPro:IPR017441), Serine/threonine-protein
FT                   kinase-like domain (InterPro:IPR017442), Concanavalin
FT                   A-like lectin/glucanase, subgroup (InterPro:IPR013320),
FT                   Protein kinase-like domain (InterPro:IPR011009),
FT                   Serine/threonine-protein kinase, active site
FT                   (InterPro:IPR008271), Protein kinase, catalytic domain
FT                   (InterPro:IPR000719), Concanavalin A-like lectin/glucanase
FT                   (InterPro:IPR008985); BEST Arabidopsis thaliana protein
FT                   match is: lectin receptor kinase a4.3 (TAIR:AT5G01560.1);
FT                   Has 1807 Blast hits to 1807 proteins in 277 species: Archae
FT                   - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants -
FT                   385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI
FT                   BLink)."
FT                   /db_xref="GOA:A0A2H1ZE50"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2H1ZE50"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CD534563.1,INSD:EH945244.1,INSD:CD534897.1,
FT                   INSD:EL158919.1,INSD:EH817813.1,INSD:EH945788.1"
FT                   /protein_id="AED90359.2"
FT                   /translation="MFLMYRSLMGTARSIISFMLVLFLLLTIPTRAQRTTTETPKTEFI
FT                   FRGFSGNQSNIVTTGAATIKLDGLLRLTDRNSNVTGTSFYHKPVRLLETNTSSTNSTIR
FT                   SFSTSFVFVIIPTSSSNGGFGFTFTLSPTPDRTGAESAQYLGLLNKANDGNSTNHVFAV
FT                   EFDTVQGFKDGADRTGNHIGLNFNSLTSDVQEPVVYYDNEDPNRKEDFPLQSGDPIRAI
FT                   LDYDGPTQTLNLTVYPANLKSRPVRPLISRPVPKLSQIVQEEMYVGFTAATGRDQSSAH
FT                   YVMGWSFSSGGDLLTEDTLDLLELPRPPPNTAKKRGYNSQVLALIVALSGVTVILLALL
FT                   FFFVMYKKRLQQGEVLEDWEINHPHRLRYKDLYAATDGFKENRIVGTGGFGTVFRGNLS
FT                   SPSSDQIAVKKITPNSMQGVREFIAEIESLGRLRHKNLVNLQGWCKQKNDLLLIYDYIP
FT                   NGSLDSLLYSRPRQSGVVLSWNARFKIAKGIASGLLYLHEEWEKVVIHRDIKPSNVLIE
FT                   DDMNPRLGDFGLARLYERGSQSNTTVVVGTIGYMAPELARNGKSSSASDVFAFGVLLLE
FT                   IVSGRRPTDSGTFFLADWVMELHARGEILHAVDPRLGFGYDGVEARLALVVGLLCCHQR
FT                   PTSRPSMRTVLRYLNGDDDVPEIDNDWGYSDSSRSDLGSNFEGYVSSDRASSSVPSFSV
FT                   TRVSSSSVISGR"
     atgtttctaa tgtaccgatc attaatgggt actgcaagat ccataatctc atttatgctc        60
     gtgctcttct tgcttttgac catccctact cgagctcaaa gaacaacaac ggagactcca       120
     aaaacagagt ttattttccg aggttttagc ggaaaccaat caaatattgt gacaacggga       180
     gctgcgacga tcaaactcga cggactattg aggctcactg accgaaactc aaacgttacc       240
     ggtacatctt tctaccacaa acctgtgaga ttgctggaga ctaatacaag ttccacaaac       300
     tccacaatcc gttcttttag cacttccttc gtatttgtca tcatccctac aagctctagc       360
     aacggaggtt ttggcttcac cttcacgcta tctccaaccc ctgatcgtac cggagccgaa       420
     tccgcacagt acttgggact tctcaacaaa gcaaacgacg ggaattcgac gaatcacgtt       480
     tttgctgtgg aattcgacac agtgcaaggt tttaaagacg gtgccgatag aacaggcaat       540
     cacatcggtc tgaatttcaa cagtttaaca tctgatgtcc aagaaccggt cgtgtattac       600
     gacaacgaag atcctaaccg gaaagaggat ttcccactac agagtggcga tccaatccga       660
     gcaattttgg attacgatgg gccaactcaa acgctaaact taactgtcta cccggctaac       720
     ttgaagtcta gacccgtaag gcctttgatc tcgcgacctg ttccaaagtt gtcgcaaatc       780
     gtgcaagaag aaatgtatgt tggattcaca gcagctacag ggagagatca gtcgagtgct       840
     cactacgtca tgggctggag tttttctagc ggcggtgatc ttctaactga agatacgctt       900
     gacctcttgg aacttcctcg tccgcctccg aacacggcga agaagagagg ttacaattct       960
     caagtactcg ctctgatcgt agctctatcg ggagtaacag tgatcttgct tgcgttactc      1020
     ttctttttcg tgatgtacaa gaaacgattg caacaaggag aggttcttga agactgggaa      1080
     atcaatcatc ctcatagact tagatataaa gatctctacg ctgctacgga tggattcaag      1140
     gagaatagga ttgtcggaac tggaggattt ggaaccgttt tccgaggaaa cttatcgtca      1200
     ccttcgtctg atcaaatcgc cgtgaagaag ataactccga atagtatgca aggtgttcga      1260
     gaattcatcg cagagatcga gagtttgggg agattaaggc ataagaatct ggtcaacctt      1320
     caaggatggt gcaagcaaaa aaacgatctc ttgttaattt atgattatat ccctaacgga      1380
     agcttagact cgctgctcta cagtagacca agacagagcg gtgttgtttt gtcgtggaac      1440
     gcacgtttta agattgctaa aggaatcgcg tctggtttgt tgtatctcca tgaagaatgg      1500
     gaaaaggttg tgattcacag agacataaaa cctagcaacg ttttgattga ggacgatatg      1560
     aatcctaggt tgggagattt tggactcgcg aggctttacg aacgcggatc gcaatcgaac      1620
     acgaccgtag tcgtgggcac aattgggtac atggcaccag agctagcacg caacggcaaa      1680
     tcttcgtctg cgtctgatgt ttttgcgttt ggcgttttgt tattagagat agtctccggg      1740
     agaagaccga ctgactcagg gacattcttc ttggccgatt gggttatgga attgcacgcg      1800
     agaggagaga ttctccatgc ggtggatccg agacttggat ttggttacga cggcgttgag      1860
     gcacggcttg ctcttgttgt gggattgctc tgttgccatc aaagaccgac gtctcggccg      1920
     tccatgagaa cggtgcttag gtatttgaac ggagatgatg atgtacctga aattgataac      1980
     gattggggat actcggattc ttcaagaagc gatttaggat ccaactttga aggatatgtt      2040
     tcatcggata gggcttcgag ctcagtccca tctttctccg ttacaagggt ttcttctagt      2100
     tctgttatca gtggtagata g                                                2121
//

If you have problems or comments...

PBIL Back to PBIL home page