(data stored in ACNUC13479 zone)

EMBL: CP002688.LECRKA4.3

CP002688.LECRKA4.3   Location/Qualifiers
FT   CDS_pept        complement(218170..220245)
FT                   /codon_start=1
FT                   /gene="LECRKA4.3"
FT                   /gene_synonym="F7A7.80"
FT                   /gene_synonym="F7A7_80"
FT                   /gene_synonym="lectin receptor kinase a4.3"
FT                   /gene_synonym="L-type lectin receptor kinase VI.4"
FT                   /gene_synonym="LecRK-VI.4"
FT                   /locus_tag="AT5G01560"
FT                   /product="lectin receptor kinase a4.3"
FT                   /note="lectin receptor kinase a4.3 (LECRKA4.3); FUNCTIONS
FT                   IN: kinase activity; INVOLVED IN: abscisic acid mediated
FT                   signaling pathway, seed germination; LOCATED IN:
FT                   endomembrane system; CONTAINS InterPro DOMAIN/s: Legume
FT                   lectin, beta chain (InterPro:IPR001220), Protein kinase,
FT                   ATP binding site (InterPro:IPR017441),
FT                   Serine/threonine-protein kinase-like domain
FT                   (InterPro:IPR017442), Concanavalin A-like lectin/glucanase,
FT                   subgroup (InterPro:IPR013320), Protein kinase-like domain
FT                   (InterPro:IPR011009), Serine/threonine-protein kinase,
FT                   active site (InterPro:IPR008271), Protein kinase, catalytic
FT                   domain (InterPro:IPR000719), Concanavalin A-like
FT                   lectin/glucanase (InterPro:IPR008985); BEST Arabidopsis
FT                   thaliana protein match is: lectin receptor kinase a4.1
FT                   (TAIR:AT5G01550.1); Has 124782 Blast hits to 123109
FT                   proteins in 4852 species: Archae - 131; Bacteria - 14218;
FT                   Metazoa - 45637; Fungi - 10709; Plants - 35284; Viruses -
FT                   441; Other Eukaryotes - 18362 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q66GN2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q66GN2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR362574.1,INSD:EH834355.1,INSD:DR284978.1,
FT                   INSD:DR284979.1,INSD:AU229014.1,INSD:EL102384.1,
FT                   INSD:DR362576.1,INSD:ES163378.1,INSD:DR284976.1,
FT                   INSD:ES121584.1,INSD:EL315375.1,INSD:DR284983.1,
FT                   INSD:EL968859.1,INSD:DR362575.1,INSD:DR362573.1,
FT                   INSD:DR383078.1,INSD:BP806064.1,INSD:DR284981.1,
FT                   INSD:AV539856.1,INSD:DR284984.1,INSD:DR284971.1,
FT                   INSD:EL115538.1,INSD:EL041740.1,INSD:DR284975.1,
FT                   INSD:ES056429.1,INSD:AU237906.1,INSD:DR284982.1,
FT                   INSD:DR284980.1,INSD:DR284974.1,INSD:BE038489.1,
FT                   INSD:DR284969.1,INSD:DR284972.1,INSD:DR280931.1,
FT                   INSD:DR284977.1,INSD:DR280932.1,INSD:ES034744.1,
FT                   INSD:CB259719.1,INSD:ES085305.1,INSD:DR284973.1,
FT                   INSD:DR284970.1,INSD:EL120899.1,INSD:DR383090.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX831757.1,INSD:BT015370.1"
FT                   /protein_id="AED90360.1"
FT                   /translation="MGRAKSMVSLLLVLFLVRAHVATTETTTEFIFHGFKGNQSEIHMQ
FT                   GDSTITSNGLLRLTDRNSDVVGTAFYHKPVRLLDSNSTNTTVRSFSTSFIFIIPSSSTS
FT                   NGGFGFTFTLSPTPNRTDADPEQYMGLLNERNDGNSSNHVFAVEFDTVQGFKDGTNRIG
FT                   NHIGLNFNSLSSDVQEPVAYFNNNDSQKEEFQLVSGEPIQVFLDYHGPTKTLNLTVYPT
FT                   RLGYKPRIPLISREVPKLSDIVVDEMFVGFTAATGRHGQSSAHYVMGWSFASGGEHPLA
FT                   AMLDISQLPPPPPNKAKKRGYNGKVIALIVALSTVISIMLVLLFLFMMYKKRMQQEEIL
FT                   EDWEIDHPHRFRYRDLYKATEGFKENRVVGTGGFGIVYRGNIRSSSDQIAVKKITPNSM
FT                   QGVREFVAEIESLGRLRHKNLVNLQGWCKHRNDLLLIYDYIPNGSLDSLLYSKPRRSGA
FT                   VLSWNARFQIAKGIASGLLYLHEEWEQIVIHRDVKPSNVLIDSDMNPRLGDFGLARLYE
FT                   RGSQSCTTVVVGTIGYMAPELARNGNSSSASDVFAFGVLLLEIVSGRKPTDSGTFFIAD
FT                   WVMELQASGEILSAIDPRLGSGYDEGEARLALAVGLLCCHHKPESRPLMRMVLRYLNRD
FT                   EDVPEIHDNWGYSDSSRTDLGSKLVGYISSDRASSSHSHTSSSLTRISSTSLISGR"
     atgggcagag caaaatccat ggtctctctc ttgttggtgc tcttccttgt tagagctcat        60
     gtagcaacaa cagagacgac aacagagttc attttccacg gtttcaaagg aaaccaatca       120
     gaaattcata tgcaaggaga ttcaaccatc acatccaacg gacttttgag gctcaccgat       180
     cgaaactcgg acgttgttgg taccgctttc taccataaac cggtgagatt gctcgacagt       240
     aactccacca atacgacggt tcgttccttt agcacttctt tcatcttcat aatcccttca       300
     agctcaacaa gcaacggagg tttcggcttc acattcacac tctctccaac cccaaaccgt       360
     acagatgcgg atcccgagca gtacatgggg cttctcaacg aaagaaacga cgggaattcg       420
     agcaatcacg ttttcgctgt ggagttcgat acggtacaag gattcaaaga cggaacaaat       480
     cgaataggca accacatcgg tctaaatttc aacagtctct cttcagatgt ccaagaacca       540
     gtggcttact tcaacaacaa cgatagtcag aaagaggaat tccaactggt gagcggcgag       600
     ccaatccaag tcttcttgga ttatcacgga ccaaccaaaa cgcttaacct cactgtttac       660
     ccaaccagat tgggatataa accaagaatc cccttgatct cacgagaggt tccaaaactg       720
     tcagatattg tcgtagacga aatgttcgtc ggattcacag cagcgactgg gagacacgga       780
     caatcgagtg ctcattacgt catgggttgg agtttcgcaa gcggtggaga acatccactt       840
     gcagctatgc tcgacatctc ccaacttcct cctccgcctc cgaataaggc gaagaagaga       900
     ggttacaatg gtaaggtcat cgctcttatc gtggctttat cgactgttat atcgatcatg       960
     ttggtgttgc tgttcctctt catgatgtac aaaaaacgaa tgcagcaaga agagattcta      1020
     gaagattggg aaatcgatca tcctcacaga tttcgataca gagacctcta caaggctact      1080
     gagggattca aggagaatag ggttgtcgga accggaggat tcggaattgt ttacagagga      1140
     aacatcagat catcgtctga tcaaatcgca gtgaagaaga taaccccaaa tagcatgcaa      1200
     ggtgttcgag aatttgtcgc ggagattgag agtttgggga gattaaggca taagaatctg      1260
     gtgaacctcc aaggatggtg taaacacaga aacgatctct tgttgatcta cgattatatt      1320
     cccaacggaa gcttggactc gctgctttac agtaaaccga gaagaagcgg agccgttttg      1380
     tcgtggaacg cgcgttttca aatcgctaaa ggaatcgcgt ctggtttgtt gtatctccac      1440
     gaagaatggg aacagatcgt gattcacaga gacgtgaaac ctagcaatgt tctgattgac      1500
     tccgatatga atcctagatt gggagacttt ggactcgcga ggctttacga acgcggatct      1560
     caatcgtgca ccaccgtagt cgtcggcacg attggatata tggcgccgga gctagcccgc      1620
     aacggaaact cctcatcagc ttccgacgtt ttcgcgtttg gcgttttgct gttagagatc      1680
     gtctccggga ggaaaccgac ggactctggg accttcttta tagccgactg ggttatggag      1740
     ctacaagcga gcggtgagat cctcagtgcg atcgacccga gactcggatc tggttacgac      1800
     gaaggagagg caaggctagc tctcgccgtc ggtttgctct gttgtcacca caaaccggaa      1860
     tctcggccgc tgatgagaat ggtgctcagg tacctgaaca gagacgaaga tgttcctgag      1920
     attcacgaca attggggata ttcagattct tcaagaacag atttaggatc gaaactcgtc      1980
     ggatacattt cgtcggatag ggcttcgagc tcacactcac acacatcttc gtctctcacc      2040
     agaatttctt caacttcttt aatcagtggt agataa                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page