(data stored in ACNUC13479 zone)

EMBL: CP002688.MAN6

CP002688.MAN6        Location/Qualifiers
FT   CDS_pept        complement(join(361189..361627,361726..362060,
FT                   362146..362340,362413..362689,362767..362867))
FT                   /codon_start=1
FT                   /gene="MAN6"
FT                   /gene_synonym="T20L15.200"
FT                   /gene_synonym="T20L15_200"
FT                   /gene_synonym="AtMAN6"
FT                   /gene_synonym="endo-beta-mannase 6"
FT                   /locus_tag="AT5G01930"
FT                   /product="Glycosyl hydrolase superfamily protein"
FT                   /note="Glycosyl hydrolase superfamily protein; FUNCTIONS
FT                   IN: cation binding, hydrolase activity, hydrolyzing
FT                   O-glycosyl compounds, catalytic activity; INVOLVED IN:
FT                   carbohydrate metabolic process; LOCATED IN: endomembrane
FT                   system; EXPRESSED IN: 19 plant structures; EXPRESSED
FT                   DURING: 10 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Glycoside hydrolase, catalytic core (InterPro:IPR017853),
FT                   Glycoside hydrolase, family 5 (InterPro:IPR001547),
FT                   Glycoside hydrolase, subgroup, catalytic core
FT                   (InterPro:IPR013781); BEST Arabidopsis thaliana protein
FT                   match is: Glycosyl hydrolase superfamily protein
FT                   (TAIR:AT5G66460.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01930"
FT                   /db_xref="GOA:Q9LZV3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZV3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:DR275249.1,INSD:EH934159.1,INSD:AA597792.1,
FT                   INSD:BP807570.1,INSD:EL989024.1,INSD:CF652410.1,
FT                   INSD:BP578231.1,INSD:AU225967.1,INSD:DR275248.1,
FT                   INSD:BP858373.1,INSD:AA713141.1,INSD:BP583233.1,
FT                   INSD:AA394852.1,INSD:BP572699.1,INSD:BP571628.1,
FT                   INSD:AU235301.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BT005831.1,INSD:BT011805.1,INSD:AK227325.1"
FT                   /protein_id="AED90411.1"
FT                   /translation="MKDQLGFRIVLCSAVFIILTQNRALADLDSESHEVNSESVGEEQW
FT                   EMVQRKGMQFTLNGQPFYVNGFNTYWMMTLAADNSTRGKVTEVFQQASAVGMTVGRTWA
FT                   FNDGQWRALQKSPSVYDEEVFKALDFVLSEARKYKIRLILSLVNNWDAYGGKAQYVKWG
FT                   NASGLNLTSDDDFFTNPTLRNFYQSHVRTVLNRVNTFTNITYKNDPTIFAWELMNEPRC
FT                   PSDPSGDKLQSWIQEMAVFVKSLDAKHLVEIGLEGFYGPSAPARTRFNPNPYAAQVGTD
FT                   FIRNNQVLGIDFASVHVYPDSWISPAVSNSFLEFTSSWMQAHVEDAEMYLGMPVLFTEF
FT                   GVSAHDPGFNTSFRDMMLNTVYKMTLNSTRKGGAGAGSLVWQVFPQGAEFMDDGYAVYL
FT                   TRAHTASKIISLQSKRLAIFNSLCSWRCRWGCKKKNQTALDALLSHDEL"
     atgaaggacc aacttggatt cagaattgtg ctctgttctg cggttttcat aattctgact        60
     caaaacagag ctctcgcaga cttggacagc gagtcccatg aggttaactc agaatcggta       120
     ggagaagaac aatgggagat ggtgcagagg aaagggatgc aattcactct aaatggacaa       180
     ccattctatg tgaatggctt caacacatac tggatgatga ctcttgcagc tgacaattcc       240
     acgagaggca aagtgacgga agtgttccaa caagcctctg cggttggaat gacggtaggc       300
     aggacatggg ctttcaacga tggccaatgg agagctctcc agaaatctcc ctctgtttac       360
     gatgaagagg tcttcaaggc cctcgacttc gtgctgagcg aggccagaaa gtacaaaatc       420
     aggcttatac tgtcattggt caacaactgg gacgcctatg gcggcaaagc tcagtacgtt       480
     aaatggggaa acgcctccgg ccttaatctc acttccgatg acgacttctt caccaacccc       540
     accctcagaa acttctacca atcccatgtc cggacagtgc tgaatagagt gaacaccttc       600
     acaaacataa cttacaagaa cgaccccaca atcttcgcct gggaacttat gaatgagcct       660
     cgttgcccct ctgatccttc cggcgacaaa ctccagtctt ggatacaaga aatggcggtg       720
     tttgtgaaga gcttagacgc taaacacttg gtggagatcg gacttgaagg cttctatggt       780
     ccctctgccc ctgcgagaac cagattcaac cccaacccct acgctgcaca agtcggaact       840
     gacttcatca gaaataatca ggttcttggc attgattttg cctcggttca cgtctatcca       900
     gattcctgga tatctccggc agtatcaaat tctttcctgg aattcacaag ctcttggatg       960
     caagctcatg ttgaggacgc agagatgtac ttgggaatgc cggttctgtt cacagagttt      1020
     ggtgtgtctg cacatgaccc tggtttcaac acgtctttcc gtgacatgat gttgaacaca      1080
     gtgtacaaga tgaccctcaa ctcaacaagg aaaggagggg ctggtgccgg gagtctggtc      1140
     tggcaggtct tccctcaggg ggcagagttc atggatgacg gctatgcggt ttacctcaca      1200
     agagctcaca cagcttcaaa aatcatatct ctgcagtcaa agcgactagc catcttcaac      1260
     tccttgtgta gctggagatg cagatgggga tgcaagaaaa agaatcagac tgctcttgat      1320
     gccctcctct cgcacgacga gctttaa                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page