(data stored in ACNUC13479 zone)

EMBL: CP002688.MSFC1

CP002688.MSFC1       Location/Qualifiers
FT   CDS_pept        complement(join(143240..143779,144172..144561))
FT                   /codon_start=1
FT                   /gene="mSFC1"
FT                   /gene_synonym="T10O8.50"
FT                   /gene_synonym="T10O8_50"
FT                   /gene_synonym="AtmSFC1"
FT                   /gene_synonym="mitochondrial succinate-fumarate carrier 1"
FT                   /locus_tag="AT5G01340"
FT                   /product="Mitochondrial substrate carrier family protein"
FT                   /note="Mitochondrial substrate carrier family protein;
FT                   FUNCTIONS IN: transporter activity, binding; INVOLVED IN:
FT                   transport, mitochondrial transport, transmembrane
FT                   transport; LOCATED IN: mitochondrial inner membrane,
FT                   membrane; EXPRESSED IN: 23 plant structures; EXPRESSED
FT                   DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
FT                   Mitochondrial substrate carrier (InterPro:IPR001993),
FT                   Mitochondrial substrate/solute carrier
FT                   (InterPro:IPR018108), Adenine nucleotide translocator 1
FT                   (InterPro:IPR002113); BEST Arabidopsis thaliana protein
FT                   match is: Mitochondrial substrate carrier family protein
FT                   (TAIR:AT2G37890.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M038"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M038"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AV824691.1,INSD:BP613840.1,INSD:BE525332.1,
FT                   INSD:AV787271.1,INSD:BP573641.1,INSD:BP578014.1,
FT                   INSD:DR376063.1,INSD:BP861137.1,INSD:BP581523.1,
FT                   INSD:BE529162.1,INSD:BP617797.1,INSD:BP575310.1,
FT                   INSD:BP574822.1,INSD:BP573328.1,INSD:BP800796.1,
FT                   INSD:DR229198.1,INSD:BP577372.1,INSD:DR229196.1,
FT                   INSD:BP567232.1,INSD:EL184388.1,INSD:BP802625.1,
FT                   INSD:AV530956.1,INSD:DR229195.1,INSD:BP576104.1,
FT                   INSD:DR229194.1,INSD:DR229197.1,INSD:DR229199.1,
FT                   INSD:EL308005.1,INSD:BP849972.1,INSD:AV556481.1,
FT                   INSD:BP804700.1,INSD:ES045272.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY052716.1,INSD:AY098957.1,INSD:BX833134.1,
FT                   INSD:AY087702.1"
FT                   /protein_id="AED90329.1"
FT                   /translation="MATRTESKKQIPPYMKAVSGSLGGVVEACCLQPIDVIKTRLQLDR
FT                   VGAYKGIAHCGSKVVRTEGVRALWKGLTPFATHLTLKYTLRMGSNAMFQTAFKDSETGK
FT                   VSNRGRFLSGFGAGVLEALAIVTPFEVVKIRLQQQKGLSPELFKYKGPIHCARTIVREE
FT                   SILGLWSGAAPTVMRNGTNQAVMFTAKNAFDILLWNKHEGDGKILQPWQSMISGFLAGT
FT                   AGPFCTGPFDVVKTRLMAQSRDSEGGIRYKGMVHAIRTIYAEEGLVALWRGLLPRLMRI
FT                   PPGQAIMWAVADQVTGLYEMRYLRNAPL"
     atggcgacga gaacggaatc gaagaagcag attccgccgt acatgaaagc agtctcaggc        60
     tcactaggcg gagtggtcga ggcttgttgt ctccaaccaa tcgacgtaat caaaacgcgt       120
     ctccagctag atcgcgtcgg cgcttacaaa ggaatcgctc actgtggttc gaaggtggtt       180
     cgcaccgaag gagttcgtgc tctctggaaa ggcttaacac cgttcgctac tcatctcacg       240
     cttaagtaca cgcttcggat gggatccaac gccatgtttc aaaccgcctt taaggattcc       300
     gagaccggaa aggtcagcaa tcgtggccgt tttctttccg gattcggtgc cggtgttctt       360
     gaagctctcg ccattgttac accctttgag gtggtgaaaa ttagacttca gcagcagaaa       420
     ggattgagtc ctgagctttt caagtacaaa ggaccaatac attgtgctag aaccatcgtg       480
     agagaagaaa gcatacttgg tttatggtca ggtgcagcac cgacggttat gcgaaacgga       540
     accaaccaag ctgtaatgtt cacagcgaaa aacgcgtttg acatactctt gtggaacaaa       600
     cacgaaggtg acggtaaaat cttgcagcca tggcagtcaa tgatctcagg gtttttagct       660
     ggaaccgcag gtccgttctg cacaggaccg tttgatgtgg tgaaaacgag gttgatggct       720
     cagagcagag acagtgaagg tgggattaga tataaaggga tggttcatgc cattagaacg       780
     atttatgcag aggaaggatt agtggcctta tggagagggt tattgccgag gctaatgagg       840
     attcctccag gacaagccat tatgtgggct gttgctgatc aagtcactgg tctttatgag       900
     atgagatatc ttcggaatgc tcctttatag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page