(data stored in ACNUC13479 zone)

EMBL: CP002688.OFP1

CP002688.OFP1        Location/Qualifiers
FT   CDS_pept        324552..325364
FT                   /codon_start=1
FT                   /gene="OFP1"
FT                   /gene_synonym="ARABIDOPSIS THALIANA OVATE FAMILY PROTEIN 1"
FT                   /gene_synonym="ATOFP1"
FT                   /gene_synonym="ovate family protein 1"
FT                   /gene_synonym="T20L15.110"
FT                   /gene_synonym="T20L15_110"
FT                   /locus_tag="AT5G01840"
FT                   /product="ovate family protein 1"
FT                   /note="ovate family protein 1 (OFP1); FUNCTIONS IN: protein
FT                   binding, transcription repressor activity; INVOLVED IN:
FT                   N-terminal protein myristoylation, regulation of
FT                   unidimensional cell growth; LOCATED IN: nucleolus,
FT                   cytoskeleton; EXPRESSED IN: 14 plant structures; EXPRESSED
FT                   DURING: 4 anthesis, F mature embryo stage, petal
FT                   differentiation and expansion stage, E expanded cotyledon
FT                   stage, D bilateral stage; CONTAINS InterPro DOMAIN/s:
FT                   Protein of unknown function DUF623 (InterPro:IPR006458);
FT                   BEST Arabidopsis thaliana protein match is: ovate family
FT                   protein 3 (TAIR:AT5G58360.1); Has 1807 Blast hits to 1807
FT                   proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 736; Fungi - 347; Plants - 385; Viruses - 0; Other
FT                   Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LZW2"
FT                   /db_xref="InterPro:IPR006458"
FT                   /db_xref="InterPro:IPR025830"
FT                   /db_xref="InterPro:IPR038933"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW2"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:AU226103.1,INSD:ES086497.1,INSD:ES136487.1,
FT                   INSD:AV549614.1,INSD:ES194491.1,INSD:AV537628.1,
FT                   INSD:ES171740.1"
FT                   /protein_id="AED90399.1"
FT                   /translation="MGNNYRFKLSELIPNAWFYKLRDMSKSKKKNLQSQPNSTTSKKKH
FT                   HAVPTPTSTTPLSPRPPRRPSHSSKAPPSHPPRKSSGNRLRHRATVDSKSSTTSGDSTT
FT                   TETGSFSPDFRSDQVLLPDESLTGSWHSPCSSKLSKTATFTPPPELELRPIITKTAATA
FT                   RKTAVNSPAGVRLRMRSPRISVSSSARRSGSSARRSRAVVKASVDPKRDFKESMEEMIA
FT                   ENKIRATKDLEELLACYLCLNSDEYHAIIINVFKQIWLDLNLPPPHSK"
     atgggtaata actatcggtt taagctatcg gagttaatcc ctaacgcttg gttttacaaa        60
     cttagagaca tgtccaaatc caagaagaag aatcttcaga gccaaccaaa tagcaccacc       120
     tccaagaaga aacaccacgc agtccctact cctacgtcca caacgccact cagtcctagg       180
     cctcctaggc gcccttctca ctcttccaaa gcgccaccct cccatcctcc caggaagtcc       240
     tccgggaacc gtcttcgtca ccgagccacc gtcgactcta agtcttccac gacttccggc       300
     gacagcacta ccacagaaac aggttctttc tcaccggact ttcgctcgga tcaagttctc       360
     ctccccgacg agtcattaac gggctcctgg cacagccctt gcagctccaa gttatccaaa       420
     accgcaacct ttacgccgcc gccggaactc gaactccggc ccatcattac caaaacggcc       480
     gccaccgcac ggaaaacggc ggtgaattct ccggcggggg tgagacttag aatgcggtcg       540
     ccgcggatct cggtgagcag cagcgcaaga agaagcgggt cgtcggctcg gcggagcagg       600
     gcggtggtga aggcgtcggt ggatccgaag agagacttta aggagtcgat ggaggagatg       660
     atcgctgaga acaagataag agcgacaaag gatctagagg agcttttggc ttgctatctc       720
     tgtctcaatt cagacgaata tcacgctatt atcatcaatg tcttcaagca aatctggctt       780
     gatcttaatc ttccaccacc ccattccaaa taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page