(data stored in ACNUC13479 zone)

EMBL: CP002688.OSH1

CP002688.OSH1        Location/Qualifiers
FT   CDS_pept        complement(join(222760..222921,223003..223095,
FT                   223203..223340,223460..223525,223610..223852))
FT                   /codon_start=1
FT                   /gene="OSH1"
FT                   /gene_synonym="F7A7.100"
FT                   /gene_synonym="F7A7_100"
FT                   /gene_synonym="OAS HIGH ACCUMULATION 1"
FT                   /locus_tag="AT5G01580"
FT                   /product="gamma interferon responsive lysosomal thiol
FT                   (GILT) reductase family protein"
FT                   /note="OAS HIGH ACCUMULATION 1 (OSH1); FUNCTIONS IN:
FT                   catalytic activity; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: endomembrane system; CONTAINS InterPro
FT                   DOMAIN/s: Gamma interferon inducible lysosomal thiol
FT                   reductase GILT (InterPro:IPR004911); BEST Arabidopsis
FT                   thaliana protein match is: Thioredoxin superfamily protein
FT                   (TAIR:AT1G07080.1); Has 1807 Blast hits to 1807 proteins in
FT                   277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi
FT                   - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339
FT                   (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01580"
FT                   /db_xref="InterPro:IPR004911"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M017"
FT                   /inference="similar to RNA sequence, EST:INSD:EG498736.1"
FT                   /protein_id="AED90362.1"
FT                   /translation="MASYQRLCITSCTIFFCLLSLSSSQKVTLSLYYEALCPFCAEFIV
FT                   NRLPKIFETGLISSIDLQLVPWGNAAIRPDGTILCQHGEAECALNAIHACAINAYPDVM
FT                   KHFGYIYCTEQLVLENKLEKWADCLEMVGLSRAAVDCYINGYGNQLEQRYAEETSELYP
FT                   AHRFVPWVVVNNLPLQENYQNFVMYVCNAYGSNQVPEACRILNSSVETLSRSNSSVEKL
FT                   SNSPQVCYSNH"
     atggcatcat atcagaggct ttgcatcaca agttgcacaa tcttcttctg cctcttatct        60
     ctgtcttcaa gccagaaagt tacactaagt ttatactacg aagctctatg ccccttctgt       120
     gcagaattca tcgtcaaccg cttgcctaag atcttcgaaa ccggcttaat ctcatccatt       180
     gatctccagc tcgttccatg gggcaacgcc gctatcagac cagatggaac cattctctgc       240
     cagcacggag aagctgagtg tgcgctcaac gcaattcatg cctgtgcaat aaacgcatac       300
     cctgatgtga tgaagcattt tggatacatc tactgtacgg aacagctagt cttggagaac       360
     aaacttgaaa aatgggctga ttgtttagaa atggttggat tgagcagagc agcggttgat       420
     tgttacatta acggatacgg aaaccagctt gaacagaggt atgctgaaga aacttctgaa       480
     ctttatccag cacatagatt tgtaccatgg gtggttgtga ataacctacc acttcaagag       540
     aactaccaga actttgtcat gtatgtatgc aatgcttatg gaagtaacca agtaccagaa       600
     gcgtgcagga tcctcaacag ttcggtggag acactaagca ggtccaatag ttcagtggag       660
     aagctaagta acagtcccca agtttgctat tccaatcact aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page