(data stored in ACNUC13479 zone)

EMBL: CP002688.PDC3

CP002688.PDC3        Location/Qualifiers
FT   CDS_pept        complement(join(132538..132708,132790..133096,
FT                   133369..134019,134093..134256,134322..134807))
FT                   /codon_start=1
FT                   /gene="PDC3"
FT                   /gene_synonym="pyruvate decarboxylase-3"
FT                   /gene_synonym="PYRUVATE DECARBOXYLASE-3"
FT                   /gene_synonym="T10O8.40"
FT                   /gene_synonym="T10O8_40"
FT                   /locus_tag="AT5G01330"
FT                   /product="pyruvate decarboxylase-3"
FT                   /note="pyruvate decarboxylase-3 (PDC3); FUNCTIONS IN: in 6
FT                   functions; CONTAINS InterPro DOMAIN/s: TPP-binding enzyme,
FT                   conserved site (InterPro:IPR000399), Thiamine pyrophosphate
FT                   enzyme, central domain (InterPro:IPR012000), Pyruvate
FT                   decarboxylase/indolepyruvate decarboxylase
FT                   (InterPro:IPR012110), Thiamine pyrophosphate enzyme,
FT                   N-terminal TPP-binding domain (InterPro:IPR012001),
FT                   Thiamine pyrophosphate enzyme, C-terminal TPP-binding
FT                   (InterPro:IPR011766); BEST Arabidopsis thaliana protein
FT                   match is: Thiamine pyrophosphate dependent pyruvate
FT                   decarboxylase family protein (TAIR:AT5G01320.1); Has 1807
FT                   Blast hits to 1807 proteins in 277 species: Archae - 0;
FT                   Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385;
FT                   Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9M039"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9M039"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:CK121737.1,INSD:BP800589.1,INSD:AU235633.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AK227701.1,INSD:BT006455.1"
FT                   /protein_id="AED90328.1"
FT                   /translation="MDVRSLPSNGVATIQDSAPTAATILGSSAATLGRHLSRRLVQAGV
FT                   TDIFTVPGDFNLSLLDQLIANPELNNIGCCNELNAGYAADGYARSRGVGACVVTFTVGG
FT                   LSVLNAIAGAYSENLPVICIVGGPNSNDFGTNRILHHTIGLPDFSQELRCFQTVTCYQA
FT                   VVNHLEDAHEQIDKAIATALRESKPVYISISCNLAAIPHPTFASYPVPFDLTPRLSNKD
FT                   CLEAAVEATLEFLNKAVKPVMVGGPKLRVAKARDAFVELADASGYPVAVMPSAKGFVPE
FT                   NHPHFIGTYWGAVSTLFCSEIVESADAYIFAGPIFNDYSSVGYSLLLKKEKAIIVHPDS
FT                   VVVANGPTFGCVRMSEFFRELAKRVKPNKTAYENYHRIFVPEGKPLKCKPREPLRINAM
FT                   FQHIQKMLSNETAVIAETGDSWFNCQKLKLPKGCGYEFQMQYGSIGWSVGATLGYAQAT
FT                   PEKRVLSFIGDGSFQVTAQDVSTMIRNGQKTIIFLINNGGYTIEVEIHDGPYNVIKNWN
FT                   YTGLVDAIHNGEGKCWTTKVRYEEELVEAINTATLEKKDSLCFIEVIVHKDDTSKELLE
FT                   WGSRVSAANGRPPNPQ"
     atggacgtcc gaagtctacc aagcaacggc gtcgcaacaa tccaagactc cgctcccacc        60
     gccgcaacca tactcggctc ctctgcagcg actcttggac gtcacttatc ccgccgtctt       120
     gtccaagccg gagtcaccga cattttcact gttcccggtg atttcaacct atctctgctt       180
     gaccagctca tcgccaaccc ggagctcaac aacatcgggt gctgtaacga gctaaacgcc       240
     ggttacgccg ccgatggata cgctcgatct cgtggagtcg gtgcttgcgt cgtgactttc       300
     accgttggtg gactcagcgt tttgaacgct atcgctggtg cgtacagtga gaacctacca       360
     gttatatgta tcgttggagg tcctaactcc aacgattttg gcactaaccg gattcttcat       420
     cacaccattg gtttacctga ttttagccaa gagcttaggt gtttccaaac tgttacttgc       480
     tatcaggctg tggtgaacca tttagaggat gctcatgaac agatcgacaa ggcgatagca       540
     acagctctga gagagagcaa gcctgtgtac attagcatca gctgtaactt agctgccatt       600
     cctcatccta catttgctag ttatcctgtc ccttttgacc taactccaag gttgagcaac       660
     aaggattgtt tagaagctgc cgtggaagca acattggagt ttctaaacaa ggccgtgaag       720
     cccgttatgg tcggtggtcc caagttgcgt gtggctaaag ctagggatgc ctttgtggag       780
     ctagctgatg cttcaggcta ccccgtggca gtgatgccat ctgccaaagg ctttgtccca       840
     gagaaccatc ctcatttcat tggcacttac tggggagcag tgagcactct tttctgctct       900
     gagattgtcg agtccgcgga tgcttacatc ttcgcaggtc caatcttcaa cgactacagc       960
     tccgttggtt actcacttct cctcaagaaa gaaaaagcca tcattgtgca tcctgatagt      1020
     gtcgttgtgg ctaatggtcc tacctttggt tgcgttcgga tgagcgaatt cttcagggag      1080
     ttggctaaga gggtgaaacc taacaagacg gcttatgaga actaccatag aatctttgtc      1140
     cctgaaggta agcctttgaa atgcaaacca agagagcctt tgagaatcaa cgcaatgttc      1200
     caacacattc agaagatgct ctctaatgaa accgctgtga ttgctgaaac tggtgattct      1260
     tggttcaatt gtcagaaact taagctgcct aaaggatgtg ggtacgagtt tcaaatgcag      1320
     tatggatcaa ttggttggtc tgttggtgcg actctaggat acgctcaagc aacaccggag      1380
     aagagagtgt tgtctttcat tggagacgga agtttccaag tgacggctca ggacgtttcc      1440
     acaatgattc gtaacggaca gaagaccatc atcttcctga tcaacaacgg tggctacacc      1500
     attgaagttg agattcatga tggtccttac aatgtgatca agaattggaa ctacactggt      1560
     cttgtcgatg ctattcataa tggtgaaggc aaatgctgga ccacaaaggt gagatacgag      1620
     gaggagttag tggaagcgat taacacggcg acattggaga agaaagatag tctttgtttc      1680
     attgaagtga ttgttcacaa ggatgatacg agcaaagagt tgcttgagtg gggctctcgc      1740
     gtctcagctg ctaatggtcg tcctcccaat cctcagtag                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page