(data stored in ACNUC13479 zone)

EMBL: CP002688.PE1

CP002688.PE1         Location/Qualifiers
FT   CDS_pept        complement(join(1388..1459,1572..1646,1745..1780,
FT                   1914..2007,2105..2181,2435..2509,2748..2799,2872..2934,
FT                   3303..3383,3543..3659,3762..3802,3927..4005,4102..4237,
FT                   4335..4467,4552..4679,4765..4924))
FT                   /codon_start=1
FT                   /gene_synonym="TOPTELOMERE.1"
FT                   /gene_synonym="TOPTELOMERE_1"
FT                   /locus_tag="AT5G01010"
FT                   /product="retinal-binding protein"
FT                   /note="EXPRESSED IN: 23 plant structures; EXPRESSED DURING:
FT                   14 growth stages; CONTAINS InterPro DOMAIN/s: GOLD
FT                   (InterPro:IPR009038)."
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01010"
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01010.4"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="InterPro:IPR036598"
FT                   /db_xref="UniProtKB/TrEMBL:F4K7W4"
FT                   /protein_id="AED90285.1"
FT                   /translation="MASTEGLMPITRAFLASYYDKYPFSPLSDDVSRLSSDMASLIKLL
FT                   TVQSPPSQGETSLIDEANRQPPHKIDENMWKNREQMEEILFLLSPSRWPVQLREPSTSE
FT                   DAEFASILRTLKDSFDNAFTAMISFQTKNSERIFSTDFRGTLIRQQKERSERNKQAEVD
FT                   ALVSSGGSIRDTYALLWKQQMERRRQLAQLGSATGVYKTLVKYLVGVPQVLLDFIRQIN
FT                   DDDGPMEEQRERYGPPLYSLTKMVIAIRVFLTLLWERYDTFKLSKDQMNLLSEAAIVYT
FT                   SEFERFVTFISDVFANSPFFISADTAGILWSRDNEEYKEIIVQAGRTYEISLMVESENS
FT                   YIAWDFSLMQGKISMLPYIRFLLLYLLLFLPDSGYLCFHTYFCCLSSVYISVVFYQDIG
FT                   FSVEYINASGEKTLILPYRRYEADQGNFSTLMAGNYKLVWDNSYSTFFKKTLRYKVDCI
FT                   APVVEPDPEPEPLN"
     atggcgtcaa cggaaggcct tatgcctatc acccgggctt ttctcgcttc ttactacgac        60
     aaatatcctt tctctcctct ttccgacgac gtttctcggc tttcctctga catggcatct       120
     ctgattaagc tattgaccgt ccaatctccc ccttcacaag gggaaacttc cctgattgac       180
     gaagcaaacc gtcagccccc tcacaaaatt gatgagaata tgtggaaaaa tagggagcag       240
     atggaggaga tactgtttct tctgtcacca tctcgctggc ctgttcagct tcgggaacct       300
     tccacatccg aagatgctga attcgcttct attttgcgga ctctcaagga cagttttgat       360
     aacgcattca ctgctatgat ttccttccag acgaagaatt ccgagcgcat attcagcaca       420
     gatttccggg gaacgctcat cagacagcag aaggagaggt cggagaggaa caaacaggcg       480
     gaggttgatg cgttggtcag ctctggaggg agcatacgcg acacatatgc tcttctttgg       540
     aagcagcaaa tggagaggag gaggcagttg gctcagctag gctctgccac tggtgtctac       600
     aaaaccctgg tcaagtactt ggtaggggtt ccacaggtgt tgttggattt tattcgacaa       660
     ataaacgatg atgatgggcc aatggaagaa cagcgagaac gttatggacc ccctctatac       720
     agtctcacaa aaatggtgat cgcaattcgg gttttcctaa cacttctgtg ggaaagatat       780
     gataccttca aactgagtaa agaccaaatg aatctcctgt ctgaagctgc tatagtctac       840
     acttctgagt ttgaaagatt cgtcacattt atcagcgatg tattcgccaa ttcccccttc       900
     tttatttcag ctgatacagc tggcatattg tggtcaaggg acaatgagga gtacaaggag       960
     ataatcgttc aagctgggag aacctatgag atctcattga tggtggaatc tgaaaattcg      1020
     tatattgctt gggatttctc tttgatgcaa ggcaagataa gcatgctgcc gtatattaga      1080
     tttttattgt tgtatctttt gctatttttg ccagactctg gttatctttg ttttcataca      1140
     tacttctgtt gtttgtcctc cgtttatatt tctgttgtct tttaccagga tatcggattt      1200
     agcgtggagt acataaatgc ttcaggggaa aagactctga tattacctta ccgtcggtat      1260
     gaagctgacc agggcaactt ctctacgcta atggctggaa actacaaact tgtttgggat      1320
     aattcatatt caactttctt caaaaagact cttcgatata aggtggattg catagcacca      1380
     gtagtggagc cggatccaga gccggagccg ttaaactga                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page