(data stored in ACNUC13479 zone)

EMBL: CP002688.PE107

CP002688.PE107       Location/Qualifiers
FT   CDS_pept        join(221367..221538,221607..221748,221828..221929,
FT                   222068..222141,222266..222270)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.90"
FT                   /gene_synonym="F7A7_90"
FT                   /locus_tag="AT5G01570"
FT                   /product="plectin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:AT5G01570"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1P8BFI9"
FT                   /protein_id="ANM70327.1"
FT                   /translation="MRDQSRNFEMVISWGDELIHVLDDRKGFDVLVQTLEQLRAIPFSC
FT                   DEDFKEIHESLQDLQKKLDVCKEKTDEANSEIADEEEIERLQKELDEELELECKLKEEL
FT                   RFIADELKDLNSQEALFEEHRLAIKRNKRDQLRTETKLPMYASVTRVIPNIDDSLKTSG
FT                   C"
     atgagagatc agtcgaggaa tttcgaaatg gtaatttcat ggggagatga attgatccat        60
     gttttggatg ataggaaagg atttgacgtg ttggtacaaa ctctcgagca actgagagct       120
     attccattct cctgcgacga agattttaaa gagatacatg aatctctcca agatttgcag       180
     aagaaactcg atgtttgcaa ggagaagaca gatgaggcaa attcagagat tgcggatgaa       240
     gaagaaattg agcgtcttca gaaagagctt gatgaagagc tagaactaga gtgcaagctg       300
     aaggaggagc ttagattcat agctgatgaa ctcaaagacc tgaattctca ggaggcatta       360
     tttgaagagc acagattagc tataaagagg aacaagcggg accagttgag aaccgagaca       420
     aagcttccta tgtatgcttc tgtcactcga gttataccaa acattgatga ttcattgaag       480
     acctcaggct gctaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page