(data stored in ACNUC13479 zone)

EMBL: CP002688.PE109

CP002688.PE109       Location/Qualifiers
FT   CDS_pept        join(224249..224942,225406..225603,225723..226005,
FT                   226096..226258,226375..226620)
FT                   /codon_start=1
FT                   /gene_synonym="F7A7.110"
FT                   /gene_synonym="F7A7_110"
FT                   /gene_synonym="TIC56"
FT                   /gene_synonym="TRANSLOCON AT THE INNER ENVELOPE MEMBRANE OF
FT                   CHLOROPLASTS 56"
FT                   /locus_tag="AT5G01590"
FT                   /product="histone-lysine N-methyltransferase ATXR3-like
FT                   protein"
FT                   /note="unknown protein; FUNCTIONS IN: molecular_function
FT                   unknown; INVOLVED IN: biological_process unknown; LOCATED
FT                   IN: chloroplast, chloroplast envelope; EXPRESSED IN: 22
FT                   plant structures; EXPRESSED DURING: 13 growth stages; Has
FT                   60 Blast hits to 59 proteins in 31 species: Archae - 0;
FT                   Bacteria - 20; Metazoa - 1; Fungi - 2; Plants - 33; Viruses
FT                   - 0; Other Eukaryotes - 4 (source: NCBI BLink)."
FT                   /db_xref="EnsemblGenomes-Tr:AT5G01590.1"
FT                   /db_xref="GOA:Q7Y1W1"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="InterPro:IPR037471"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7Y1W1"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:EH911764.1,INSD:EL290968.1,INSD:EH931539.1,
FT                   INSD:EL218017.1,INSD:AV823461.1,INSD:ES143249.1,
FT                   INSD:EL092353.1,INSD:ES120172.1,INSD:EL007365.1,
FT                   INSD:EL256320.1,INSD:AV831658.1,INSD:EL181728.1,
FT                   INSD:EL056969.1,INSD:EL283437.1,INSD:AV557842.1,
FT                   INSD:EL101886.1,INSD:AV818493.1,INSD:EH926525.1,
FT                   INSD:AV813268.1,INSD:EL177726.1,INSD:AV561759.1,
FT                   INSD:DR276411.1,INSD:EL198314.1,INSD:EL202109.1,
FT                   INSD:DR382050.1,INSD:AV817315.1,INSD:ES131814.1,
FT                   INSD:EL135187.1,INSD:EL098402.1,INSD:DR276406.1,
FT                   INSD:BP828760.1,INSD:BP792244.1,INSD:EH990670.1,
FT                   INSD:DR276407.1,INSD:EL000021.1,INSD:EL302326.1,
FT                   INSD:EL151413.1,INSD:AV793234.1,INSD:DR276410.1,
FT                   INSD:DR276413.1,INSD:ES130922.1,INSD:ES049605.1,
FT                   INSD:BP828158.1,INSD:EL267266.1,INSD:DR276408.1,
FT                   INSD:DR276414.1,INSD:EL053299.1,INSD:EL968234.1,
FT                   INSD:DR295561.1,INSD:EL213418.1,INSD:DR276409.1,
FT                   INSD:BP793384.1,INSD:EL204742.1,INSD:EH879547.1,
FT                   INSD:EH958482.1,INSD:EL249641.1,INSD:EL336451.1,
FT                   INSD:BP808788.1,INSD:EL021518.1,INSD:DR359650.1,
FT                   INSD:BP669191.1,INSD:AV795594.1,INSD:AV804151.1,
FT                   INSD:EL307140.1,INSD:AV810236.1,INSD:ES136729.1,
FT                   INSD:DR276412.1,INSD:BP778634.1,INSD:BP788608.1,
FT                   INSD:BP792470.1,INSD:BP829643.1,INSD:EL041791.1,
FT                   INSD:ES030362.1,INSD:ES114159.1,INSD:EL261902.1,
FT                   INSD:AV794834.1,INSD:BP785319.1,INSD:EL050969.1,
FT                   INSD:AV784430.1,INSD:BP809697.1,INSD:ES161261.1,
FT                   INSD:AV788755.1,INSD:AV795289.1,INSD:AV794545.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:AY050767.1,INSD:BT008696.1"
FT                   /protein_id="AED90363.1"
FT                   /translation="MSSMNFNPFQNWFEKPPNPVPSINFVSLADSFFPKSQSPNFASIG
FT                   LPKFSKKSPKPETAGTDEPGPYKQIAEQFLWECENIPDYRHTPEVDKLLNEDPVFEKKE
FT                   NPSTEEIEAEQKWWESFRASPVVQFMTRAEEIADDMNKMELEDNDTPYRKEDKDYWRAI
FT                   PHVPGFDGRPMPRKAIKSKEESDDKFWDFMKQFLFGLWGFRQRPYPPGRPIDVAQAIGY
FT                   KRLEKRYYDFIMKTGGWWYKDRLGRSRGPCEIITLKTAYGAGIIDRDTFIWGEDMDEWA
FT                   PIHMVYGLEPAIATWEVRLGAAATAFLHKLQKGIPPWVPLKGREPKTYKQLQKEAIESK
FT                   KRDMAVLEANGGVWPGVRTPSHALFLWASGSELTTVLESDHMPNKFIPKQLRLELAKVI
FT                   PGLRPWEVISIEQAMDQISYGGEWYREPLGTYTTGPPYIREWNRSVMRLFRIFYNLSVR
FT                   VGQKLERTVPGFDTIMDKVQKDYDKRIARRMKRREEELREEDLKHYSGRTDEDEEEEEE
FT                   EDDDSNSKKD"
     atgtcgtcga tgaacttcaa tccatttcaa aactggttcg agaaaccacc gaacccagtc        60
     ccgtccatca acttcgtctc gctcgctgat tccttctttc ccaagtcgca gtctccgaat       120
     ttcgcttcga ttggacttcc aaaattctca aagaagtccc caaaacccga aacagcagga       180
     accgacgaac caggaccgta caagcaaata gcagagcagt tcttatggga gtgtgagaac       240
     ataccggatt acaggcacac tccagaagtg gataagcttc tcaacgaaga tccagttttc       300
     gagaagaagg agaatccgag cacagaagag attgaagctg agcagaaatg gtgggagagt       360
     tttcgagcga gtcctgtggt tcagtttatg actcgcgccg aggagattgc cgacgatatg       420
     aacaagatgg agctcgagga taacgacacg ccttatcgga aagaagacaa ggattactgg       480
     agagccattc ctcatgtccc gggctttgac gggaggccca tgcctaggaa ggcgatcaaa       540
     tcaaaggaag agagtgatga taagttttgg gatttcatga aacagtttct cttcggcctc       600
     tggggtttcc gtcaacgtcc ttacccgcct ggtcgaccca ttgatgtggc tcaggctatt       660
     ggttacaaac ggctcgagaa gcgctattat gacttcataa tgaagactgg tggttggtgg       720
     tataaagacc gacttggccg ttctagaggc ccttgtgaga ttataaccct taagacggct       780
     tatggagctg gaataattga cagagatact ttcatttggg gcgaggacat ggatgaatgg       840
     gcgcctattc acatggttta cggtttggaa cctgcaattg caacttggga agtgaggctt       900
     ggtgcagcgg caacggcttt cctacacaaa ctccagaagg gaattccacc gtgggttcca       960
     ttaaagggac gagagccaaa aacatacaag cagcttcaaa aagaagctat tgagagtaag      1020
     aaacgcgaca tggcagtgct tgaagcaaat ggtggcgttt ggcctggagt cagaactccc      1080
     agccacgctc tgtttctctg ggccagtggg tctgagttaa caactgtact ggaatctgat      1140
     cacatgccga acaagttcat ccccaaacaa ctacgactag agttggccaa agtaatacca      1200
     gggttaaggc catgggaagt gataagtatc gagcaagcta tggatcagat cagctatggt      1260
     ggagagtggt accgtgagcc gcttggtacc tacaccactg gtcctcctta tatcagagag      1320
     tggaatagga gtgtcatgag gctattccgg attttctaca acctgagtgt tcgagtaggc      1380
     cagaagctgg agaggacagt cccgggtttt gacactataa tggacaaagt tcagaaagat      1440
     tatgacaaaa ggattgctcg gaggatgaag cggagagagg aggagctgag agaagaggac      1500
     ctgaagcatt attccggccg taccgatgaa gatgaggagg aggaagagga ggaggacgac      1560
     gatagcaact ccaaaaaaga ttga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page