(data stored in ACNUC13479 zone)

EMBL: CP002688.PE11

CP002688.PE11        Location/Qualifiers
FT   CDS_pept        join(10638..12665,12797..13003)
FT                   /codon_start=1
FT                   /gene_synonym="F7J8.10"
FT                   /gene_synonym="F7J8_10"
FT                   /locus_tag="AT5G01030"
FT                   /product="enolase, putative (DUF3527)"
FT                   /note="Protein of unknown function (DUF3527); FUNCTIONS IN:
FT                   molecular_function unknown; INVOLVED IN: biological_process
FT                   unknown; LOCATED IN: cellular_component unknown; EXPRESSED
FT                   IN: 24 plant structures; EXPRESSED DURING: 13 growth
FT                   stages; CONTAINS InterPro DOMAIN/s: Protein of unknown
FT                   function DUF3527 (InterPro:IPR021916); BEST Arabidopsis
FT                   thaliana protein match is: Protein of unknown function
FT                   (DUF3527) (TAIR:AT2G37930.1); Has 1807 Blast hits to 1807
FT                   proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa
FT                   - 736; Fungi - 347; Plants - 385; Viruses - 0; Other
FT                   Eukaryotes - 339 (source: NCBI BLink)."
FT                   /db_xref="GOA:Q9LFD3"
FT                   /db_xref="InterPro:IPR021916"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFD3"
FT                   /inference="similar to RNA sequence,
FT                   EST:INSD:BP628641.1,INSD:AV784392.1,INSD:EG507809.1,
FT                   INSD:AV539116.1,INSD:EL096876.1,INSD:EG510072.1,
FT                   INSD:DR366772.1,INSD:BG459331.1,INSD:AV522932.1,
FT                   INSD:EG510074.1,INSD:AV551489.1,INSD:EG507815.1,
FT                   INSD:BP605912.1,INSD:AV823430.1,INSD:BP616094.1,
FT                   INSD:AV547029.1,INSD:EG510066.1,INSD:AV548054.1,
FT                   INSD:BP616398.1"
FT                   /inference="similar to RNA sequence,
FT                   mRNA:INSD:BX831094.1,INSD:BT002362.1,INSD:AY096641.1"
FT                   /protein_id="AED90289.1"
FT                   /translation="MAEKEGKASGTDNDNRVKTKRSSHSRRKECVNKSLEHNDELVKYM
FT                   SKLPGYLQRIERGEESVHQSNVLNVGVLDWESLQRWKHGRAKGGEISGRSERKVSTIAT
FT                   TSTSGVVVPNDSANRCKIDDQVHTCSNLGKVKASRDLQYSLEPQLASRDSLNKQEIATC
FT                   SYKSSGRDHKGVEPRKSRRTHSNRESTTGLSSEMGNSAGSLFRDKETQKRAGEIHAKEA
FT                   RERAKECVEKLDGDEKIIGDSEAGLTSEKQEFSNIFLLRSRKQSRSTLSGEPQISREVN
FT                   RSLDFSDGINSSFGLRSQIPSSCPLSFDLERDSEDMMLPLGTDLSGKRGGKRHSKTTSR
FT                   IFDREFPEDESRKERHPSPSKRFSFSFGRLSRNFSLKDISAGQPLSSSEDTIMSGSMRF
FT                   DGSVCPSQSSNPENQNTHCRSRVSPLRRFLDPLLKPKASESVLPSKARSSSSNPKPITN
FT                   SNVPLQDEKKQDASRTLAIFQLTIRNGIPLFQFVVDDNSSSSRSILGATMKSSDSSFKD
FT                   DSVQYCTFYSVNEVKKKKSGSWLIHGHREKHCGFVYNIIGQMQLGNSMSVDISEQKSLI
FT                   TESVLFDESEQVKGRKEVAAVVIKKKPVEGSYTSFEETSVIIPGGVHSFPEKGAPSPLI
FT                   SRWRSGGLCDCGGWDVGCKLHVLSNKTVLHKFNQSFTLFDQEVSEQDSSPALAMTELKT
FT                   GIYRVEFGSFVSPLQAFFVCVTVLTCASKAKTTGKSSSPMAPPLSPVGRV"
     atggcagaaa aggagggtaa agcaagtggc acagacaatg acaatcgggt gaaaacgaaa        60
     cgttcaagtc atagtcgtcg aaaggaatgt gtcaataaga gtttggaaca taatgatgag       120
     cttgtgaaat atatgtccaa gttgccaggt tatctccaac gtatagagag aggtgaagaa       180
     agcgttcatc aaagtaatgt tttgaatgtt ggagtcttgg attgggaaag tctacagaga       240
     tggaagcatg gtcgagcaaa aggcggtgaa atatcaggaa gaagtgagag aaaagtgtct       300
     actattgcta ctacttctac ttcaggagta gtagttccca atgactcggc taataggtgt       360
     aagattgatg accaagtgca tacttgttcg aatctcggta aagttaaagc ttcccgggat       420
     cttcaatatt ctctagaacc tcagctggct tctagggatt cattaaataa gcaggaaata       480
     gcaacttgta gctataagtc ctctggtaga gatcacaaag gagtagaacc gaggaagagc       540
     agaagaacgc attcaaaccg ggaatccact acaggtttat cgtcagaaat gggaaactct       600
     gcggggtcac ttttccggga taaagagact cagaagagag caggggagat acatgcaaag       660
     gaagcaagag aaagagctaa agaatgtgtt gagaagttag atggggatga gaagatcatt       720
     ggcgattcgg aagctggtct tacttctgaa aagcaggagt tcagcaacat ttttctcctt       780
     cgatcaagaa aacagtcccg aagcactctt tccggtgagc ctcaaatctc aagggaggtt       840
     aaccgctctc tagacttttc cgacggaatc aatagctctt tcggattgag atctcaaatt       900
     cctagttcct gtccactctc tttcgactta gagagagatt ctgaagatat gatgttgcct       960
     cttggtactg atctttctgg taaaagaggt gggaaaaggc attcaaagac aacttcaagg      1020
     atatttgatc gagaatttcc tgaagatgaa tccagaaagg agagacaccc ttcaccaagc      1080
     aagcgattta gttttagttt tggtcgtctc agccgaaatt tcagcctgaa agatatttca      1140
     gccggccaac ctttgagttc ttctgaggat accattatgt ctggttctat gagatttgat      1200
     ggttcagttt gtccatctca gtcaagtaac ccggagaacc agaacactca ttgcagatct      1260
     cgagttagcc ctctaaggcg gtttcttgac cctttactga aaccaaaagc ctctgaaagt      1320
     gttcttccat caaaagcaag atcaagttct tccaatccaa agccaataac caacagcaac      1380
     gtaccacttc aagatgaaaa gaagcaggat gcatcgagaa ccctagctat ttttcagctc      1440
     acaatcagaa atggcatccc tttgtttcaa tttgtggtcg atgataacag cagcagcagc      1500
     aggagcattc tcggggctac aatgaaaagc tcagattcat cgttcaaaga tgattctgtt      1560
     cagtactgca cattctactc tgttaatgaa gtcaaaaaga aaaaaagtgg aagctggcta      1620
     atccatggac acagagagaa acattgcggg ttcgtctaca acataatcgg tcaaatgcag      1680
     ttgggaaact caatgagcgt agatatatca gagcagaaat ctttgatcac agagtcagtt      1740
     ctgtttgacg aatcagagca agtaaaaggg aggaaggagg ttgcagctgt agtgatcaag      1800
     aagaagcctg tcgaaggaag ctataccagc ttcgaggaaa ctagtgtgat aattccaggc      1860
     ggcgttcaca gcttccccga gaaaggagca ccgtcgccat tgattagccg gtggaggtct      1920
     ggagggttat gcgactgcgg tggctgggat gttggatgta aactacatgt cctctccaac      1980
     aaaacagtcc tccataaatt caaccaaagc ttcacacttt tcgatcagga agtgagtgaa      2040
     caagactcga gtccagcttt ggcgatgaca gagctgaaga cagggatcta tagggtggag      2100
     tttggttcgt ttgtttcacc gttacaagcg ttttttgtgt gtgtgacggt actaacatgt      2160
     gcttccaagg caaagaccac cggaaaatct tcttctccta tggctccgcc gctatctccc      2220
     gttggtagag tctaa                                                       2235
//

If you have problems or comments...

PBIL Back to PBIL home page